(data stored in ACNUC7421 zone)

EMBL: AP010803.CZCB

AP010803.CZCB        Location/Qualifiers
FT   CDS             complement(545924..547105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="SJA_C1-05390"
FT                   /product="metal ion efflux membrane fusion protein family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95373"
FT                   /db_xref="GOA:D4YYE1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE1"
FT                   /protein_id="BAI95373.1"
FT                   /translation="MMKSFYLAGAASLALLLAACGGKDGGNEATAEGAAANETAAGTEK
FT                   GGAEGGHAGEGVVTLGADQIATAGVQVGRPIIGGAGTIELPAIIEGDPQGTQVVSAAIA
FT                   GRVVALTRNLGQSVGRGQTIAVIESREAAQIKGEVEAARARLQLANSNLAREQRLFAQR
FT                   VSPEQDLIAARTAATEARIALTQAQSMVSAAGVGGGGLNRLGIAAPISGQIIARPVTLG
FT                   QTVAADAELYRIANLSQVSIALNLKPEDAGRVRPGNTVLVKAAGRQATARVTFVSPALD
FT                   PQTRLVPALATLDNRGGEWRVGEPVTAAVQLTGSGGSGAVRVPTTAVQSFEGKSVVFVR
FT                   TPTGFKATPVQLGDASGDTVIVRSGLTGNEQIATTGSFTLKAEIGKGEASHED"
     MMKSFYLAGA ASLALLLAAC GGKDGGNEAT AEGAAANETA AGTEKGGAEG GHAGEGVVTL        60
     GADQIATAGV QVGRPIIGGA GTIELPAIIE GDPQGTQVVS AAIAGRVVAL TRNLGQSVGR       120
     GQTIAVIESR EAAQIKGEVE AARARLQLAN SNLAREQRLF AQRVSPEQDL IAARTAATEA       180
     RIALTQAQSM VSAAGVGGGG LNRLGIAAPI SGQIIARPVT LGQTVAADAE LYRIANLSQV       240
     SIALNLKPED AGRVRPGNTV LVKAAGRQAT ARVTFVSPAL DPQTRLVPAL ATLDNRGGEW       300
     RVGEPVTAAV QLTGSGGSGA VRVPTTAVQS FEGKSVVFVR TPTGFKATPV QLGDASGDTV       360
     IVRSGLTGNE QIATTGSFTL KAEIGKGEAS HED                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page