(data stored in ACNUC7421 zone)

EMBL: AP010803.CZCC

AP010803.CZCC        Location/Qualifiers
FT   CDS             524497..525759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="SJA_C1-05230"
FT                   /product="cation resistance protein CzcC"
FT                   /note="heavy metal RND efflux outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95357"
FT                   /db_xref="GOA:D4YYC5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC5"
FT                   /protein_id="BAI95357.1"
FT                   /translation="MIMMPRRAVRRLLLSIGATLASAWAVPVSAGPLTYEQAVRLAAAN
FT                   APSLKARAAATAGARSSAVAADRLPDPTLDLGLQNFPVSGPNAGSFTRDDFTMATIGFS
FT                   QTFPNLAKRHARAARAAADIGIAEAGELVEGRNVRLETALAWVDLYYGERRLRQLDLLD
FT                   ASLDDLQKTVTARLASGSARPSQALEPDQLRAAIADRRAEMAAVVAQARARLARYTGDP
FT                   DPQATGDPPMLDVDPIRLRAGIDALPALRAQDARIAVAEADVRLARADKRPDWKVGVTY
FT                   GRRDPMYGDMASVGVSIDLPLFAGKRQNPRIAASESLAQGGRFDREAIRRELVAQLDAD
FT                   LADHAMHLSRLRNARETLVPLARHRAELDRDSYGAGKLDLGAALLTTLGLAEAEVEALN
FT                   READVARDAVRITITYGEERP"
     MIMMPRRAVR RLLLSIGATL ASAWAVPVSA GPLTYEQAVR LAAANAPSLK ARAAATAGAR        60
     SSAVAADRLP DPTLDLGLQN FPVSGPNAGS FTRDDFTMAT IGFSQTFPNL AKRHARAARA       120
     AADIGIAEAG ELVEGRNVRL ETALAWVDLY YGERRLRQLD LLDASLDDLQ KTVTARLASG       180
     SARPSQALEP DQLRAAIADR RAEMAAVVAQ ARARLARYTG DPDPQATGDP PMLDVDPIRL       240
     RAGIDALPAL RAQDARIAVA EADVRLARAD KRPDWKVGVT YGRRDPMYGD MASVGVSIDL       300
     PLFAGKRQNP RIAASESLAQ GGRFDREAIR RELVAQLDAD LADHAMHLSR LRNARETLVP       360
     LARHRAELDR DSYGAGKLDL GAALLTTLGL AEAEVEALNR EADVARDAVR ITITYGEERP       420
//

If you have problems or comments...

PBIL Back to PBIL home page