(data stored in ACNUC7421 zone)

EMBL: AP010803.DAT

AP010803.DAT         Location/Qualifiers
FT   CDS             complement(204184..205035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dat"
FT                   /locus_tag="SJA_C1-01970"
FT                   /product="D-alanine transaminase"
FT                   /EC_number="2.6.1.21"
FT                   /note="D-amino acid aminotransferase / branched-chain amino
FT                   acid aminotransferase / 4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95031"
FT                   /db_xref="GOA:D4YXE9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE9"
FT                   /protein_id="BAI95031.1"
FT                   /translation="MSIAYLNGRFVPLEQAQVSVLDRGFLFADGIYEVAAVIDGRLVDS
FT                   ASHLARLERSTGAIGIALPLSLAEVEAAQKELVARNGLTEGLVYLQITRGADATRDFLP
FT                   SPGIAPTLVMFVQAKPFLDVPAARNGIAVATMPDLRWARRDIKSVGLLAQAMAKRAAAE
FT                   AGAQEAWMVEDGFVTEGASSTAFIVTDEGIVTRPYSQAVLAGCTGAALNALAEESGIAV
FT                   IRRPFAVAEALAAREAFIASASTLCQSVVRIDGQAIGDGKPGPVAMRLRALYIDFARRT
FT                   AV"
     MSIAYLNGRF VPLEQAQVSV LDRGFLFADG IYEVAAVIDG RLVDSASHLA RLERSTGAIG        60
     IALPLSLAEV EAAQKELVAR NGLTEGLVYL QITRGADATR DFLPSPGIAP TLVMFVQAKP       120
     FLDVPAARNG IAVATMPDLR WARRDIKSVG LLAQAMAKRA AAEAGAQEAW MVEDGFVTEG       180
     ASSTAFIVTD EGIVTRPYSQ AVLAGCTGAA LNALAEESGI AVIRRPFAVA EALAAREAFI       240
     ASASTLCQSV VRIDGQAIGD GKPGPVAMRL RALYIDFARR TAV                         283
//

If you have problems or comments...

PBIL Back to PBIL home page