(data stored in ACNUC7421 zone)

EMBL: AP010803.DNAE

AP010803.DNAE        Location/Qualifiers
FT   CDS             426890..430162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="SJA_C1-04130"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95247"
FT                   /db_xref="GOA:D4YY15"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY15"
FT                   /protein_id="BAI95247.1"
FT                   /translation="MTAPRYAELQVTSHFSFLRGASSCEELFSQAALAGIEALAVVDRN
FT                   SLAGIVRAHQAAKTTGVRLIVGCRLDLVDGASMLVYPTDRSAYSRLCRLLSLGKQRAGK
FT                   AKCHLEWPDLMAYGEGLIVVLVPDQADAECALRLRRLRDAFGDRAYLALTLRRRPNDQL
FT                   RIHELSNLATQMRVPTVVTNDVLFHEPARRVLQDVVTCIRHNVTIDALGDRRERHADRY
FT                   IKPPEEMHRLFARYPEALARTLQIADRCRFNLDELAYQYPEERDDPALTPQETLAKLTW
FT                   EGAAQRYPEGVPDSVIAALRHELRLIEKLGYAPYFLTVNAIVRFARSKDILCQGRGSAA
FT                   NSAVCYVLGITSIDPGRNDLLFERFVSEERREPPDIDVDFEHERREIVMQWVFDTYGRD
FT                   HAALCSTVIRYRTKGALRDVGKALGLPEDLIGTLSSQVWAWSEEGVEQRHVEALNLNLA
FT                   DRRLRLTLDLARQLMGAPRHLSQHPGGFVLTHDRLDDLVPIEPAAMKDRQVIEWDKDDI
FT                   DALKFMKVDVLALGMLTCMKKGLDLLAEHKGVNLDLASIPAEDPRTYAMIRKADTLGTF
FT                   QIESRAQMSMLPRLKPRTYYDLVVQVAIVRPGPIQGDMVHPYLRRREGLEPVHYPKPEL
FT                   EKVLGKTLGVPLFQEQAMRVAIECAGFTPGEADMLRKSMATFKFTGGVSHFRDKLIAGM
FT                   VANGYEQAFAEQTFKQLEGFGSYGFPESHAASFALIAYASAWLKCWHPDVFCAALLNSQ
FT                   PMGFYAPAQIVRDAIEHGVDVRPVCANASRWDCTLEPTSDESRYAVRLGLRMVKGLANT
FT                   HGAAIVSARADQPYTSIDDLWRRAGAPSAALVQLAEADAFRPALGLARREALWAIKALR
FT                   DEPLPLFAAASAREAGAIPEIDEPAVALRPMTAGGEVVEDYGHVGLTLRTHPLSFLRED
FT                   LQRRRIVTCAEAMAARDGRWVEAAGIVLVRQRPGSAKGVMFITLEDETGIANLVVWTKV
FT                   FEANRRAILSASMIAVRGRVQREGEVVHLVAQRITDLSGELASVGDRDMAFPLSHGRGD
FT                   QVRHGGSGPDPRELPPKGLRTRDIYIPDLHIDTIKVKTRDFR"
     MTAPRYAELQ VTSHFSFLRG ASSCEELFSQ AALAGIEALA VVDRNSLAGI VRAHQAAKTT        60
     GVRLIVGCRL DLVDGASMLV YPTDRSAYSR LCRLLSLGKQ RAGKAKCHLE WPDLMAYGEG       120
     LIVVLVPDQA DAECALRLRR LRDAFGDRAY LALTLRRRPN DQLRIHELSN LATQMRVPTV       180
     VTNDVLFHEP ARRVLQDVVT CIRHNVTIDA LGDRRERHAD RYIKPPEEMH RLFARYPEAL       240
     ARTLQIADRC RFNLDELAYQ YPEERDDPAL TPQETLAKLT WEGAAQRYPE GVPDSVIAAL       300
     RHELRLIEKL GYAPYFLTVN AIVRFARSKD ILCQGRGSAA NSAVCYVLGI TSIDPGRNDL       360
     LFERFVSEER REPPDIDVDF EHERREIVMQ WVFDTYGRDH AALCSTVIRY RTKGALRDVG       420
     KALGLPEDLI GTLSSQVWAW SEEGVEQRHV EALNLNLADR RLRLTLDLAR QLMGAPRHLS       480
     QHPGGFVLTH DRLDDLVPIE PAAMKDRQVI EWDKDDIDAL KFMKVDVLAL GMLTCMKKGL       540
     DLLAEHKGVN LDLASIPAED PRTYAMIRKA DTLGTFQIES RAQMSMLPRL KPRTYYDLVV       600
     QVAIVRPGPI QGDMVHPYLR RREGLEPVHY PKPELEKVLG KTLGVPLFQE QAMRVAIECA       660
     GFTPGEADML RKSMATFKFT GGVSHFRDKL IAGMVANGYE QAFAEQTFKQ LEGFGSYGFP       720
     ESHAASFALI AYASAWLKCW HPDVFCAALL NSQPMGFYAP AQIVRDAIEH GVDVRPVCAN       780
     ASRWDCTLEP TSDESRYAVR LGLRMVKGLA NTHGAAIVSA RADQPYTSID DLWRRAGAPS       840
     AALVQLAEAD AFRPALGLAR REALWAIKAL RDEPLPLFAA ASAREAGAIP EIDEPAVALR       900
     PMTAGGEVVE DYGHVGLTLR THPLSFLRED LQRRRIVTCA EAMAARDGRW VEAAGIVLVR       960
     QRPGSAKGVM FITLEDETGI ANLVVWTKVF EANRRAILSA SMIAVRGRVQ REGEVVHLVA      1020
     QRITDLSGEL ASVGDRDMAF PLSHGRGDQV RHGGSGPDPR ELPPKGLRTR DIYIPDLHID      1080
     TIKVKTRDFR                                                             1090
//

If you have problems or comments...

PBIL Back to PBIL home page