(data stored in ACNUC7421 zone)

EMBL: AP010803.DNAQ

AP010803.DNAQ        Location/Qualifiers
FT   CDS             3036..3728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="SJA_C1-00050"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94839"
FT                   /db_xref="GOA:D4YWV7"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV7"
FT                   /protein_id="BAI94839.1"
FT                   /translation="MREIIFDTETTGFDPASGDRLVEIGCIELLNRVPTGRTFHAYYNP
FT                   QRSMPAAAEAVHGLSDSFLRDKPLFSHGVEELLAFLEDSHLVAHNARFDFGFLNHELRL
FT                   CGLPEVSMARMIDTVAIARQLHPGAKHSLDALCTRYGIDRSHRIKHGALLDAELLAQLY
FT                   IELTGGRQIGLGLAQEEEKRVANMELAAEVAVRPVRPARVFAASAEELERHAAFVATLE
FT                   KPLWLEEA"
     MREIIFDTET TGFDPASGDR LVEIGCIELL NRVPTGRTFH AYYNPQRSMP AAAEAVHGLS        60
     DSFLRDKPLF SHGVEELLAF LEDSHLVAHN ARFDFGFLNH ELRLCGLPEV SMARMIDTVA       120
     IARQLHPGAK HSLDALCTRY GIDRSHRIKH GALLDAELLA QLYIELTGGR QIGLGLAQEE       180
     EKRVANMELA AEVAVRPVRP ARVFAASAEE LERHAAFVAT LEKPLWLEEA                  230
//

If you have problems or comments...

PBIL Back to PBIL home page