(data stored in ACNUC7421 zone)

EMBL: AP010803.DPS

AP010803.DPS         Location/Qualifiers
FT   CDS             104735..105226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="SJA_C1-01050"
FT                   /product="starvation-inducible DNA-binding protein"
FT                   /note="DNA-binding ferritin-like protein (oxidative damage
FT                   protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94939"
FT                   /db_xref="GOA:D4YX57"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX57"
FT                   /protein_id="BAI94939.1"
FT                   /translation="MTSPDLKTPTDLRSNATKSVAEALNGVLADSYALYFKTKNFHWHV
FT                   SGPHFRDYHLMFDEQATQILATTDLIAERVRKTGNTTLRSIGDISRHQSLVDNDADYVS
FT                   PGDMLNELREDNLKLVESLRAAKAAATEAGDNATEGIIDDWTDEAEERAWFLFEAGRNG
FT                   "
     MTSPDLKTPT DLRSNATKSV AEALNGVLAD SYALYFKTKN FHWHVSGPHF RDYHLMFDEQ        60
     ATQILATTDL IAERVRKTGN TTLRSIGDIS RHQSLVDNDA DYVSPGDMLN ELREDNLKLV       120
     ESLRAAKAAA TEAGDNATEG IIDDWTDEAE ERAWFLFEAG RNG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page