(data stored in ACNUC7421 zone)

EMBL: AP010803.FABI

AP010803.FABI        Location/Qualifiers
FT   CDS             complement(182359..183153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="SJA_C1-01740"
FT                   /product="enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95008"
FT                   /db_xref="GOA:D4YXC6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC6"
FT                   /protein_id="BAI95008.1"
FT                   /translation="MAGKRGLIMGLANDKSLAWGISKALHAQGAELAFSYQGEALAKRV
FT                   RPLAEELGSDFLIDCDVSDMEKLDAAFAEIEAKWGRLDFVVHAIGFSDKNELRGLYVDT
FT                   SLENFLLTMNISAYSFVAVAKRARALMPEGGSLLTLSYYGAEKVIPHYNVMGVAKAALE
FT                   TSVKYLAMDLGPENIRVNAISAGPIKTLAASGIGDFRYIMKWNELNSPLRRNVTIEDVG
FT                   GAGLYLLSDLASGVTGEVHHVDAGYNVIGMKAEDAPDIALDK"
     MAGKRGLIMG LANDKSLAWG ISKALHAQGA ELAFSYQGEA LAKRVRPLAE ELGSDFLIDC        60
     DVSDMEKLDA AFAEIEAKWG RLDFVVHAIG FSDKNELRGL YVDTSLENFL LTMNISAYSF       120
     VAVAKRARAL MPEGGSLLTL SYYGAEKVIP HYNVMGVAKA ALETSVKYLA MDLGPENIRV       180
     NAISAGPIKT LAASGIGDFR YIMKWNELNS PLRRNVTIED VGGAGLYLLS DLASGVTGEV       240
     HHVDAGYNVI GMKAEDAPDI ALDK                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page