(data stored in ACNUC7421 zone)

EMBL: AP010803.FADB

AP010803.FADB        Location/Qualifiers
FT   CDS             153842..154756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="SJA_C1-01480"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94982"
FT                   /db_xref="GOA:D4YXA0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA0"
FT                   /protein_id="BAI94982.1"
FT                   /translation="MAIDLRGRVAIVTGAGGGLGREHALLLAKRGARVLVNDLGGASDG
FT                   RSAAAEAVAEEIRRNGGEAISNGADVTDVDQVAAMVEQAKAAWGRIDILVNNAGILRDR
FT                   TFVKQSLDDFRLVIEVHLMGSVNCTKAVWGEMIEQGYGRIVMTTSSSGLYGNFGQSQYG
FT                   AAKMGLVGLMKTLSLEGRRNDVRVNCLAPTAATGMTEGILDEQALAALDPALVAPGMLA
FT                   LVCDDAPNGMILCAGAGSFECAHITLTQGLYVGADAHAPERILAGIDRIRERAGEMVPV
FT                   AGMEQSNHELSRVPALQSAAADG"
     MAIDLRGRVA IVTGAGGGLG REHALLLAKR GARVLVNDLG GASDGRSAAA EAVAEEIRRN        60
     GGEAISNGAD VTDVDQVAAM VEQAKAAWGR IDILVNNAGI LRDRTFVKQS LDDFRLVIEV       120
     HLMGSVNCTK AVWGEMIEQG YGRIVMTTSS SGLYGNFGQS QYGAAKMGLV GLMKTLSLEG       180
     RRNDVRVNCL APTAATGMTE GILDEQALAA LDPALVAPGM LALVCDDAPN GMILCAGAGS       240
     FECAHITLTQ GLYVGADAHA PERILAGIDR IRERAGEMVP VAGMEQSNHE LSRVPALQSA       300
     AADG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page