(data stored in ACNUC7421 zone)

EMBL: AP010803.FADH

AP010803.FADH        Location/Qualifiers
FT   CDS             complement(311348..312430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="SJA_C1-02950"
FT                   /product="2,4-dienoyl-CoA reductase (NADPH2)"
FT                   /EC_number="1.3.1.34"
FT                   /note="NADH:flavin oxidoreductase, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95129"
FT                   /db_xref="GOA:D4YXP7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP7"
FT                   /protein_id="BAI95129.1"
FT                   /translation="MANLFEPVQLGAIHAPNRVLMAPLTRARATRDHVPTPIMADYYRQ
FT                   RASAGLIISEGIGVSRQGLGWPYAAGLWSAEQVEGWKLVTAAVHEAGGRIFAQLWHMGR
FT                   LVHSSMTGEQPISSSPVTAPGHAHSYDGNKPYEQPRALGIEEIPALVQTYVTAARNAIE
FT                   AGFDGVQIHGANGYLIDEFLRDGVNRREDAYGGPPENRVRLLREITQAVADAIGADRTA
FT                   VRLSLNGDSQGTDDSDPASLSLAVAQALDPIGLAFLELRELRTDGTRGASDVPRQSPLI
FT                   RQHYRGPLVLNSDYDAARAQADLDSGLAQAISFGRPFISNPDLPERLSTGAPLSPLRQE
FT                   TLYTQGAEGYVDYPALEKVA"
     MANLFEPVQL GAIHAPNRVL MAPLTRARAT RDHVPTPIMA DYYRQRASAG LIISEGIGVS        60
     RQGLGWPYAA GLWSAEQVEG WKLVTAAVHE AGGRIFAQLW HMGRLVHSSM TGEQPISSSP       120
     VTAPGHAHSY DGNKPYEQPR ALGIEEIPAL VQTYVTAARN AIEAGFDGVQ IHGANGYLID       180
     EFLRDGVNRR EDAYGGPPEN RVRLLREITQ AVADAIGADR TAVRLSLNGD SQGTDDSDPA       240
     SLSLAVAQAL DPIGLAFLEL RELRTDGTRG ASDVPRQSPL IRQHYRGPLV LNSDYDAARA       300
     QADLDSGLAQ AISFGRPFIS NPDLPERLST GAPLSPLRQE TLYTQGAEGY VDYPALEKVA       360
//

If you have problems or comments...

PBIL Back to PBIL home page