(data stored in ACNUC7421 zone)

EMBL: AP010803.FEOA

AP010803.FEOA        Location/Qualifiers
FT   CDS             313349..313624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="SJA_C1-02970"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95131"
FT                   /db_xref="GOA:D4YXP9"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP9"
FT                   /protein_id="BAI95131.1"
FT                   /translation="MTSALPLRLTDLPLRQPAYVDLIDWNALSASDGQRLREFGLCEGA
FT                   SVEALHHGGLLGRGPIACKVGRMTIAMRRSHAAAITVRTGPSDGDL"
     MTSALPLRLT DLPLRQPAYV DLIDWNALSA SDGQRLREFG LCEGASVEAL HHGGLLGRGP        60
     IACKVGRMTI AMRRSHAAAI TVRTGPSDGD L                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page