(data stored in ACNUC7421 zone)

EMBL: AP010803.FEOB

AP010803.FEOB        Location/Qualifiers
FT   CDS             313621..315480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="SJA_C1-02980"
FT                   /product="Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95132"
FT                   /db_xref="GOA:D4YXQ0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ0"
FT                   /protein_id="BAI95132.1"
FT                   /translation="MTNLPLIALVGNPNAGKSALFNALTGARQKLGNYPGVTVERKAGR
FT                   LSLSDGRPIELVDLPGTYSLSPTSPDEQVTRDVILGRQAGERLPDALVVVVDASNLDNH
FT                   LRFALELIALGLPTVVALNMVDLATRDGLELDAHILSRELGVPVISTVAVRKRGLDHLR
FT                   GELETMLDGSAGKARAPGEQSDFEGLRREARRIARAAVVRETPSRRLTAAVDRAALHPV
FT                   AGLVLLLALLFIMFQAVYAWSEAPIAMIEGFVASAGDAVTAALPDGLLRSFLVDGVLNG
FT                   VGSVIVFLPQILILFFFILMLEATGYMVRAAFLMDGLMARVGLSGRAFIPLLSSFACAV
FT                   PGIMATRTIADPKDRLTTILIAPLMTCSARLPVYAVIIGAFIPARTVALGIGLQGLVLF
FT                   CLYISGIVGAMLAALVLRRTVTRGASGGFLMEMPKYQWPRPQDIVLGLWQRAVIFLKRA
FT                   GTIIFTSTVILWVLLSFPKAPEDGAVSQVNYSIAGRVANGLNLVLAPIGFNRDISLALI
FT                   PAMAAREVAVSALATVYSLDADEDEARLERSLGDRLKDNWPLPTALAFLAWFVFAPQCI
FT                   STIAVTRRETNGWKWPLFMIGYLFALAYAAAGLTYWTATAAGL"
     MTNLPLIALV GNPNAGKSAL FNALTGARQK LGNYPGVTVE RKAGRLSLSD GRPIELVDLP        60
     GTYSLSPTSP DEQVTRDVIL GRQAGERLPD ALVVVVDASN LDNHLRFALE LIALGLPTVV       120
     ALNMVDLATR DGLELDAHIL SRELGVPVIS TVAVRKRGLD HLRGELETML DGSAGKARAP       180
     GEQSDFEGLR REARRIARAA VVRETPSRRL TAAVDRAALH PVAGLVLLLA LLFIMFQAVY       240
     AWSEAPIAMI EGFVASAGDA VTAALPDGLL RSFLVDGVLN GVGSVIVFLP QILILFFFIL       300
     MLEATGYMVR AAFLMDGLMA RVGLSGRAFI PLLSSFACAV PGIMATRTIA DPKDRLTTIL       360
     IAPLMTCSAR LPVYAVIIGA FIPARTVALG IGLQGLVLFC LYISGIVGAM LAALVLRRTV       420
     TRGASGGFLM EMPKYQWPRP QDIVLGLWQR AVIFLKRAGT IIFTSTVILW VLLSFPKAPE       480
     DGAVSQVNYS IAGRVANGLN LVLAPIGFNR DISLALIPAM AAREVAVSAL ATVYSLDADE       540
     DEARLERSLG DRLKDNWPLP TALAFLAWFV FAPQCISTIA VTRRETNGWK WPLFMIGYLF       600
     ALAYAAAGLT YWTATAAGL                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page