(data stored in ACNUC7421 zone)

EMBL: AP010803.GIDA

AP010803.GIDA        Location/Qualifiers
FT   CDS             complement(28105..29955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SJA_C1-00290"
FT                   /product="NAD/FAD-utilizing enzyme apparently involved in
FT                   cell division"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94863"
FT                   /db_xref="GOA:D4YWY1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY1"
FT                   /protein_id="BAI94863.1"
FT                   /translation="MRTSYDVIVVGGGHAGCEAAGAAARKGAAVTLLTFERATVGAMSC
FT                   NPAIGGLGKGHLVREVDALDGLIARAADAAAIHYRMLNSSKGAAVQGPRVQADRKRYRA
FT                   EIHRLLDAQSGLEIVEGEAVGLLLAEGAVAGLSLADGRRLHAPSVVLATGTFLGGKLFR
FT                   GEETLTGGRISERAATALGVQLRALDLPMGRLKTGTPPRIDGRTIDWAALEAQPSDAEG
FT                   WTMSALSPGRPLPQLSCAITRTNDRTHAIIREGLGRSPLFSGAIEGRGPRYCPSIEDKV
FT                   IRFGDRDGHQIFLEPEGLDDHLVYPNGISTSLPADVQLAMVRSMAGLEKADIRVPGYAV
FT                   EYDHIDPRALDATLEVQAIPGLFCAGQINGTTGYEEAAAQGLLAGINAAARARGEGPLI
FT                   LDRASSYIGVMIDDLVLQGVTEPYRMLTARAEYRLRLRADNAGTRLAEIGFEHGVLGEE
FT                   RAAYYARRHDERAAVEEELSRTFSATEMARSGAPVRQDGARRSLFEWARFPEVGRSLLC
FT                   ELAPTLSRISHDLREELLEDAHYAPYLERQEAEIAEMRRNERVVIPAGFDFAAIGGLST
FT                   EMVERLTLARPDTLAAAGRIRGITPAALAALLVHIRRRAA"
     MRTSYDVIVV GGGHAGCEAA GAAARKGAAV TLLTFERATV GAMSCNPAIG GLGKGHLVRE        60
     VDALDGLIAR AADAAAIHYR MLNSSKGAAV QGPRVQADRK RYRAEIHRLL DAQSGLEIVE       120
     GEAVGLLLAE GAVAGLSLAD GRRLHAPSVV LATGTFLGGK LFRGEETLTG GRISERAATA       180
     LGVQLRALDL PMGRLKTGTP PRIDGRTIDW AALEAQPSDA EGWTMSALSP GRPLPQLSCA       240
     ITRTNDRTHA IIREGLGRSP LFSGAIEGRG PRYCPSIEDK VIRFGDRDGH QIFLEPEGLD       300
     DHLVYPNGIS TSLPADVQLA MVRSMAGLEK ADIRVPGYAV EYDHIDPRAL DATLEVQAIP       360
     GLFCAGQING TTGYEEAAAQ GLLAGINAAA RARGEGPLIL DRASSYIGVM IDDLVLQGVT       420
     EPYRMLTARA EYRLRLRADN AGTRLAEIGF EHGVLGEERA AYYARRHDER AAVEEELSRT       480
     FSATEMARSG APVRQDGARR SLFEWARFPE VGRSLLCELA PTLSRISHDL REELLEDAHY       540
     APYLERQEAE IAEMRRNERV VIPAGFDFAA IGGLSTEMVE RLTLARPDTL AAAGRIRGIT       600
     PAALAALLVH IRRRAA                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page