(data stored in ACNUC7421 zone)

EMBL: AP010803.GLNB

AP010803.GLNB        Location/Qualifiers
FT   CDS             complement(199329..199667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="SJA_C1-01910"
FT                   /product="nitrogen regulatory protein P-II 1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95025"
FT                   /db_xref="GOA:D4YXE3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE3"
FT                   /protein_id="BAI95025.1"
FT                   /translation="MKLVMAIIKPFKLDDVREALSSLGIAGMTVSEVKGFGRQKGQTEI
FT                   YRGAEYSTNMVPKIKIEVVCDDDLAPRVIEAVQAAANSGAIGDGKIFVLDVEQAVRIRT
FT                   GETGETAL"
     MKLVMAIIKP FKLDDVREAL SSLGIAGMTV SEVKGFGRQK GQTEIYRGAE YSTNMVPKIK        60
     IEVVCDDDLA PRVIEAVQAA ANSGAIGDGK IFVLDVEQAV RIRTGETGET AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page