(data stored in SCRATCH zone)

EMBL: AP010803.GUAA

AP010803.GUAA        Location/Qualifiers
FT   CDS             complement(584135..585694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="SJA_C1-05730"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="GMP synthase - PP-ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95407"
FT                   /db_xref="GOA:D4YYH5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYH5"
FT                   /protein_id="BAI95407.1"
FT                   /translation="MTLPLQDSILIVDFGSQVTQLIARRVREAGVYSEIAPFNNAAEAF
FT                   ERLKPKGIILSGGPSSVMWEDSPRAPQHFFDAGVPVLGICYGQQTMMQQLGGNVEGGES
FT                   GEFGRAFIEVKKGCALFDGLWSEGEKHQVWMSHGDKVTRLAPGFEVVAVSEGAPYAITA
FT                   NEEKRFYATQFHPEVVHTPDGAKLLANFVRHVCGLKGDWTMAEFRATKIADIRAQVGEG
FT                   RVICGLSGGVDSAVAAVLIHEAIGDQLTCVFVDHGLMRLGEAEQVVSLFREHYGIKLVH
FT                   VNAEERFLGGLAGLTDPEKKRKFIGGEFIAVFEEEAKKIGGADFLAQGTLYPDVIESVS
FT                   FTGGPSVTIKSHHNVGGLPERMNMKLVEPLRELFKDEVRVLGRELGLPEIFVGRHPFPG
FT                   PGLAIRIPGEVSKERCDILRKADAVYLEEIRNAGLYDAIWQAFAVLLPVRTVGVMGDYR
FT                   TYDSVCALRAVTSTDGMTADIYPFDAAFLSRVATRIINEVKGINRVVYDYTSKPPGTIE
FT                   WE"
     MTLPLQDSIL IVDFGSQVTQ LIARRVREAG VYSEIAPFNN AAEAFERLKP KGIILSGGPS        60
     SVMWEDSPRA PQHFFDAGVP VLGICYGQQT MMQQLGGNVE GGESGEFGRA FIEVKKGCAL       120
     FDGLWSEGEK HQVWMSHGDK VTRLAPGFEV VAVSEGAPYA ITANEEKRFY ATQFHPEVVH       180
     TPDGAKLLAN FVRHVCGLKG DWTMAEFRAT KIADIRAQVG EGRVICGLSG GVDSAVAAVL       240
     IHEAIGDQLT CVFVDHGLMR LGEAEQVVSL FREHYGIKLV HVNAEERFLG GLAGLTDPEK       300
     KRKFIGGEFI AVFEEEAKKI GGADFLAQGT LYPDVIESVS FTGGPSVTIK SHHNVGGLPE       360
     RMNMKLVEPL RELFKDEVRV LGRELGLPEI FVGRHPFPGP GLAIRIPGEV SKERCDILRK       420
     ADAVYLEEIR NAGLYDAIWQ AFAVLLPVRT VGVMGDYRTY DSVCALRAVT STDGMTADIY       480
     PFDAAFLSRV ATRIINEVKG INRVVYDYTS KPPGTIEWE                              519
//

If you have problems or comments...

PBIL Back to PBIL home page