(data stored in ACNUC7421 zone)

EMBL: AP010803.GYRB

AP010803.GYRB        Location/Qualifiers
FT   CDS             complement(47877..50384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SJA_C1-00470"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94881"
FT                   /db_xref="GOA:D4YWZ9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ9"
FT                   /protein_id="BAI94881.1"
FT                   /translation="MSEESQNNPNSNAYGADSIKVLKGLDAVRKRPGMYIGDTDDGSGL
FT                   HHMVFEVSDNAIDEALAGHCDRILITLNPDGSVSVEDNGRGIPTDIHKEEGVSAAEVIM
FT                   TQLHAGGKFENTSDDNAYKVSGGLHGVGVSVVNALSEYLDLNIWRDGKEHYMRFAYGDA
FT                   VAPLKVIGDAPEGKKGTKVTFLPSTEKVPGDGGTFKNHTEFDFEKLEHRYRELAFLNSG
FT                   VRLFLADARHEEKKEIELFYEGGIAAFVKWLDRNKQPLMPDPIAISGSRDDVTIDVALE
FT                   WNDSYYENVLCFTNNIPQRDGGTHLAAFRAALTRTLNNYADKSGLLKKEKVSLTGEDMR
FT                   EGLTAIVSVKLPDPKFSSQTKDKLVSSEVRQPLESLMADKMAEWLEENPQHGRMIVQKV
FT                   IDAAAAREAAKKARELTRRKGVMDIASLPGKLADCQERDPAKSELFLVEGDSAGGSAKQ
FT                   GRNRHNQAILPLKGKILNVERARFDRMLSSKEVGTLIQAMGTGIRDDFNLEKLRYHKIV
FT                   IMTDADVDGAHIRTLLLTFFYRQMPQIIEAGHLYIAQPPLYKATRGRSEVYLKNEAALE
FT                   NYLVDNGVESMALETTGGMRSGEDLRSLIEHGRRIRAVMRYVPRRYNPAIIEALAINGA
FT                   LDPELSHDAQAERLANTVRWMDAQDDEGRWSGRIAEEGGFHFERLWRGVTDHHMIEAGF
FT                   IGSAEARKLHAIAAEEADSYRTSSRLVTAKAAAAAEEAGEDELPVATKGSATVTRPSEL
FT                   LEAILTAGRKGLAIQRYKGLGEMNAEQLWETTLDPDNRSMLRVEVEQADVADEIFTRLM
FT                   GDVVEPRREFIQDNALNVANLDV"
     MSEESQNNPN SNAYGADSIK VLKGLDAVRK RPGMYIGDTD DGSGLHHMVF EVSDNAIDEA        60
     LAGHCDRILI TLNPDGSVSV EDNGRGIPTD IHKEEGVSAA EVIMTQLHAG GKFENTSDDN       120
     AYKVSGGLHG VGVSVVNALS EYLDLNIWRD GKEHYMRFAY GDAVAPLKVI GDAPEGKKGT       180
     KVTFLPSTEK VPGDGGTFKN HTEFDFEKLE HRYRELAFLN SGVRLFLADA RHEEKKEIEL       240
     FYEGGIAAFV KWLDRNKQPL MPDPIAISGS RDDVTIDVAL EWNDSYYENV LCFTNNIPQR       300
     DGGTHLAAFR AALTRTLNNY ADKSGLLKKE KVSLTGEDMR EGLTAIVSVK LPDPKFSSQT       360
     KDKLVSSEVR QPLESLMADK MAEWLEENPQ HGRMIVQKVI DAAAAREAAK KARELTRRKG       420
     VMDIASLPGK LADCQERDPA KSELFLVEGD SAGGSAKQGR NRHNQAILPL KGKILNVERA       480
     RFDRMLSSKE VGTLIQAMGT GIRDDFNLEK LRYHKIVIMT DADVDGAHIR TLLLTFFYRQ       540
     MPQIIEAGHL YIAQPPLYKA TRGRSEVYLK NEAALENYLV DNGVESMALE TTGGMRSGED       600
     LRSLIEHGRR IRAVMRYVPR RYNPAIIEAL AINGALDPEL SHDAQAERLA NTVRWMDAQD       660
     DEGRWSGRIA EEGGFHFERL WRGVTDHHMI EAGFIGSAEA RKLHAIAAEE ADSYRTSSRL       720
     VTAKAAAAAE EAGEDELPVA TKGSATVTRP SELLEAILTA GRKGLAIQRY KGLGEMNAEQ       780
     LWETTLDPDN RSMLRVEVEQ ADVADEIFTR LMGDVVEPRR EFIQDNALNV ANLDV            835
//

If you have problems or comments...

PBIL Back to PBIL home page