(data stored in ACNUC7421 zone)

EMBL: AP010803.HEMK

AP010803.HEMK        Location/Qualifiers
FT   CDS             63047..63874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="SJA_C1-00640"
FT                   /product="methylase of polypeptide chain release factors"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94898"
FT                   /db_xref="GOA:D4YX16"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX16"
FT                   /protein_id="BAI94898.1"
FT                   /translation="MGVAVALREAVERLTPISATPRLDAELLLAHALRIDRNTLLLRQR
FT                   DLSVPPGFDALIQRRLTGEPIAYITGTRDFWTISLHVTPDVLIPRPDSETLIEAALDHF
FT                   GPRSPARILDLGTGSGALLLAALSQWPQATGTGVDISPAAVAVAQGNADRLGLGGRANF
FT                   RLGDWAEGMGGPFDLILVNPPYIARDAALAGDVLHEPETALFAGAEGLDDYRRIAPALP
FT                   RLLAPGGMAAMEIGHDQRLSVSALLADQGLGVSPRRDLAGHDRCLVATPGPSA"
     MGVAVALREA VERLTPISAT PRLDAELLLA HALRIDRNTL LLRQRDLSVP PGFDALIQRR        60
     LTGEPIAYIT GTRDFWTISL HVTPDVLIPR PDSETLIEAA LDHFGPRSPA RILDLGTGSG       120
     ALLLAALSQW PQATGTGVDI SPAAVAVAQG NADRLGLGGR ANFRLGDWAE GMGGPFDLIL       180
     VNPPYIARDA ALAGDVLHEP ETALFAGAEG LDDYRRIAPA LPRLLAPGGM AAMEIGHDQR       240
     LSVSALLADQ GLGVSPRRDL AGHDRCLVAT PGPSA                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page