(data stored in ACNUC7421 zone)

EMBL: AP010803.HISZ

AP010803.HISZ        Location/Qualifiers
FT   CDS             complement(190491..191621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="SJA_C1-01830"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /note="ATP phosphoribosyltransferase involved in histidine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95017"
FT                   /db_xref="GOA:D4YXD5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD5"
FT                   /protein_id="BAI95017.1"
FT                   /translation="MTTIPSGLLPEGLSDRLPPLAEASAWLARRVLDTVASHGYERVMP
FT                   PIAEFEDTLVSRLKSMKAQDLVRAIDPVSQRSLALRPDMTAQVGRIAATRLAAAPRPLR
FT                   LSYAGPVIRLRANQLRPERERFQIGAELIGSDSVAAAVEIVNVAIEALQAAGVTGITID
FT                   FTLPDLIDALAAGPLPLAPEEIEAVRAELDAKDAGALAAISPAAAAYLPLIEGTGPFHA
FT                   AMERLEALNADLGGAIDSRIAGLRAIAKPIGWDISLTLDPTERHGFEYQNWFGFSIFAE
FT                   GFTGEIGRGGSYAIIRADGSEEPAMGFSLYPDPLIDAGFGGEAPRRLFLPLHHDAARAA
FT                   QLRAEGWQTVAALTPQENGEALRCSHWLDGTEPRPY"
     MTTIPSGLLP EGLSDRLPPL AEASAWLARR VLDTVASHGY ERVMPPIAEF EDTLVSRLKS        60
     MKAQDLVRAI DPVSQRSLAL RPDMTAQVGR IAATRLAAAP RPLRLSYAGP VIRLRANQLR       120
     PERERFQIGA ELIGSDSVAA AVEIVNVAIE ALQAAGVTGI TIDFTLPDLI DALAAGPLPL       180
     APEEIEAVRA ELDAKDAGAL AAISPAAAAY LPLIEGTGPF HAAMERLEAL NADLGGAIDS       240
     RIAGLRAIAK PIGWDISLTL DPTERHGFEY QNWFGFSIFA EGFTGEIGRG GSYAIIRADG       300
     SEEPAMGFSL YPDPLIDAGF GGEAPRRLFL PLHHDAARAA QLRAEGWQTV AALTPQENGE       360
     ALRCSHWLDG TEPRPY                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page