(data stored in ACNUC7421 zone)

EMBL: AP010803.HLYD

AP010803.HLYD        Location/Qualifiers
FT   CDS             300336..301508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyD"
FT                   /locus_tag="SJA_C1-02860"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95120"
FT                   /db_xref="GOA:D4YXN8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN8"
FT                   /protein_id="BAI95120.1"
FT                   /translation="MNYETSLVGDAPANVLGEQEERSVWRRRLTIGAVVAIVLIAVATW
FT                   VGMRGNGADAPANAAQAPVVTVISPGRSTVSNTVSATGSLAARVEMPVGVVGEGGAVTR
FT                   VLVQPGDWVRAGQVLATVERSVQTEQIRSLAAQVEVARADAKLAQAQLDRAKSLVSRGF
FT                   ISQADIDQRTATRDAANARVNVAAAQLAEQRARTGRLDIRAPAAGLVLTRAVEPGQIVS
FT                   AGSAVLFRMAKGGEMEMLAQVSEGDLAAIRPGNSATVTPVGGTAQFAGRIWQVSPVVDN
FT                   QTRQGIARIAIPYDPAIRPGGFASAAIVSGSGSAPMLPESAVQSDEKGNFVYVVNGRNE
FT                   VQRRDVKIGQVTDAGVSILNGLNGDERIVASAGAFLTPGQKVKPEAGKSK"
     MNYETSLVGD APANVLGEQE ERSVWRRRLT IGAVVAIVLI AVATWVGMRG NGADAPANAA        60
     QAPVVTVISP GRSTVSNTVS ATGSLAARVE MPVGVVGEGG AVTRVLVQPG DWVRAGQVLA       120
     TVERSVQTEQ IRSLAAQVEV ARADAKLAQA QLDRAKSLVS RGFISQADID QRTATRDAAN       180
     ARVNVAAAQL AEQRARTGRL DIRAPAAGLV LTRAVEPGQI VSAGSAVLFR MAKGGEMEML       240
     AQVSEGDLAA IRPGNSATVT PVGGTAQFAG RIWQVSPVVD NQTRQGIARI AIPYDPAIRP       300
     GGFASAAIVS GSGSAPMLPE SAVQSDEKGN FVYVVNGRNE VQRRDVKIGQ VTDAGVSILN       360
     GLNGDERIVA SAGAFLTPGQ KVKPEAGKSK                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page