(data stored in ACNUC7421 zone)

EMBL: AP010803.HTPX

AP010803.HTPX        Location/Qualifiers
FT   CDS             264383..265312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="SJA_C1-02490"
FT                   /product="heat shock protein HtpX"
FT                   /note="Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95083"
FT                   /db_xref="GOA:D4YXK1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK1"
FT                   /protein_id="BAI95083.1"
FT                   /translation="MNGMKTAMLLSALTALFMALGYTLGGSGGAAIALLVAAGMNLFTF
FT                   WNADRIVLSMHNAREVDAQSAPEFYTLVAELARRAGLPMPRVYLIDQPHPNAFATGRDP
FT                   DHAAVAATTGLLSMLSRDEVAGVMAHELGHVRNRDTLIMTMVATIAGAISMLANFGLFF
FT                   RGGNQENGHGNIAATLLAVIVAPFAAMIVQMAISRTREYGADRAGAEISGNPRALASAL
FT                   AKISGRAETIPNPVAERNPAAAQLYIVPVHVSELFSTHPATEKRIAALEEMAGGAPLPR
FT                   RASALSPAASSAAPKGRKSSALDPLRRD"
     MNGMKTAMLL SALTALFMAL GYTLGGSGGA AIALLVAAGM NLFTFWNADR IVLSMHNARE        60
     VDAQSAPEFY TLVAELARRA GLPMPRVYLI DQPHPNAFAT GRDPDHAAVA ATTGLLSMLS       120
     RDEVAGVMAH ELGHVRNRDT LIMTMVATIA GAISMLANFG LFFRGGNQEN GHGNIAATLL       180
     AVIVAPFAAM IVQMAISRTR EYGADRAGAE ISGNPRALAS ALAKISGRAE TIPNPVAERN       240
     PAAAQLYIVP VHVSELFSTH PATEKRIAAL EEMAGGAPLP RRASALSPAA SSAAPKGRKS       300
     SALDPLRRD                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page