(data stored in ACNUC7421 zone)

EMBL: AP010803.LIGX

AP010803.LIGX        Location/Qualifiers
FT   CDS             240236..241528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligX"
FT                   /locus_tag="SJA_C1-02290"
FT                   /product="DDVA O-demethylase"
FT                   /EC_number="1.14.-.-"
FT                   /note="phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95063"
FT                   /db_xref="GOA:D4YXI1"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXI1"
FT                   /protein_id="BAI95063.1"
FT                   /translation="MLSEEKNRQLTQVGPGTPMGELLRRYWMPIAAEGELDKKPVKAVR
FT                   LMGEDLVLYRDLGGQLGLTDRHCPHRRADLSYGFVEKCGIRCNYHGWLFDEQGACLEQP
FT                   YEDTVLGGGTRDKVSITAYPVRALGGLIWAYLGPSPAPELPEYEAFNWPNGFRQIILSD
FT                   IPCNWAQCQENSIDPVHFEWMHSNWSVRLKGEEGPYAPRHLKIGFEEFEHGFLYKRIRE
FT                   DTDEEHDLWSVGRAMIWPIGIFLGDHFEWRVPVDDENSLSVAWSFQRMPIESEPFVQER
FT                   IPYWRGPVTDAEGNWISSHVMNQDFIAWVGQGRIADRTKERLGRSDLGIGLMRRQLFAD
FT                   MEAVARGEDPKGIIRDPALAKNIPLPLVHAERYRSGMPREKLVAHPVLGRHLRAYPYQY
FT                   GQPTEVLESIWRAAGVTREDFGIGTDAEPME"
     MLSEEKNRQL TQVGPGTPMG ELLRRYWMPI AAEGELDKKP VKAVRLMGED LVLYRDLGGQ        60
     LGLTDRHCPH RRADLSYGFV EKCGIRCNYH GWLFDEQGAC LEQPYEDTVL GGGTRDKVSI       120
     TAYPVRALGG LIWAYLGPSP APELPEYEAF NWPNGFRQII LSDIPCNWAQ CQENSIDPVH       180
     FEWMHSNWSV RLKGEEGPYA PRHLKIGFEE FEHGFLYKRI REDTDEEHDL WSVGRAMIWP       240
     IGIFLGDHFE WRVPVDDENS LSVAWSFQRM PIESEPFVQE RIPYWRGPVT DAEGNWISSH       300
     VMNQDFIAWV GQGRIADRTK ERLGRSDLGI GLMRRQLFAD MEAVARGEDP KGIIRDPALA       360
     KNIPLPLVHA ERYRSGMPRE KLVAHPVLGR HLRAYPYQYG QPTEVLESIW RAAGVTREDF       420
     GIGTDAEPME                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page