(data stored in ACNUC7421 zone)

EMBL: AP010803.LUXR

AP010803.LUXR        Location/Qualifiers
FT   CDS             complement(410441..411238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR"
FT                   /locus_tag="SJA_C1-03990"
FT                   /product="LuxR-family transcriptional regulator"
FT                   /note="DNA-binding HTH domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95233"
FT                   /db_xref="GOA:D4YY01"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY01"
FT                   /protein_id="BAI95233.1"
FT                   /translation="MSAAGRSCAMPSAALIDAVRFSEPGGIGPAAERLRDAVMDLCGLR
FT                   TAVTHNVASREPMRDGNGAVLASEIFGFRGEEPRWWEVPQLALSSPIVHACRVEAEPFW
FT                   CNAHGFFTRLPNPLLDVIDLHDFRIRAMTAAAIVVPIHLPFGQIGAASFLSPEPEANDL
FT                   SDAYACAADALAVLARAFVQSYVKVTARARPGLGSISLTKREVECLRWAAAGKTNEEIG
FT                   IILGLQRTTVRFHIRSASVKLDAVNRDQTMFKAAQLGFLGMIN"
     MSAAGRSCAM PSAALIDAVR FSEPGGIGPA AERLRDAVMD LCGLRTAVTH NVASREPMRD        60
     GNGAVLASEI FGFRGEEPRW WEVPQLALSS PIVHACRVEA EPFWCNAHGF FTRLPNPLLD       120
     VIDLHDFRIR AMTAAAIVVP IHLPFGQIGA ASFLSPEPEA NDLSDAYACA ADALAVLARA       180
     FVQSYVKVTA RARPGLGSIS LTKREVECLR WAAAGKTNEE IGIILGLQRT TVRFHIRSAS       240
     VKLDAVNRDQ TMFKAAQLGF LGMIN                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page