(data stored in ACNUC7421 zone)

EMBL: AP010803.MAF

AP010803.MAF         Location/Qualifiers
FT   CDS             complement(281465..281962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="SJA_C1-02660"
FT                   /product="septum formation protein"
FT                   /note="nucleotide-binding protein implicated in inhibition
FT                   of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95100"
FT                   /db_xref="GOA:D4YXL8"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL8"
FT                   /protein_id="BAI95100.1"
FT                   /translation="MDPADLDETPLKGELPAAYAARVAAEKGALVAARHPGALVLSGDT
FT                   VVAAGRRILPKTESEAEARQCLQLLSGRRHRVLSAITLIDAEGKARHRLSTNIVTFKRL
FT                   DRAEIDAYLASQEWQGKAGGYAIQGRAAGLIRAIQGSHSAIMGLPLYETRALLRAAGYP
FT                   LD"
     MDPADLDETP LKGELPAAYA ARVAAEKGAL VAARHPGALV LSGDTVVAAG RRILPKTESE        60
     AEARQCLQLL SGRRHRVLSA ITLIDAEGKA RHRLSTNIVT FKRLDRAEID AYLASQEWQG       120
     KAGGYAIQGR AAGLIRAIQG SHSAIMGLPL YETRALLRAA GYPLD                       165
//

If you have problems or comments...

PBIL Back to PBIL home page