(data stored in ACNUC7421 zone)

EMBL: AP010803.MARC

AP010803.MARC        Location/Qualifiers
FT   CDS             complement(681585..682202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marC"
FT                   /locus_tag="SJA_C1-06790"
FT                   /product="MarC-family membrane protein"
FT                   /note="multiple antibiotic resistance protein / integral
FT                   membrane protein of the MarC family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95513"
FT                   /db_xref="GOA:D4YYT1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT1"
FT                   /protein_id="BAI95513.1"
FT                   /translation="MTELFISAFVTLFVVIDPPGCAPIYASLTTCATQVQRRSMAIRAV
FT                   AIAAGILLLFALWGKQLLGTLGIELDSFRIAGGIMLFIIAMDMVFEKRTQRREDRAQKI
FT                   AETPEVEDVSVFPMAMPMIAGPGSIATVMLLMSRAEGLSERLVVIGAVVVTLVLMLASL
FT                   LAAGPIMALLGAKIEAVITRLLGVLLAALAAQFVIDGLKASF"
     MTELFISAFV TLFVVIDPPG CAPIYASLTT CATQVQRRSM AIRAVAIAAG ILLLFALWGK        60
     QLLGTLGIEL DSFRIAGGIM LFIIAMDMVF EKRTQRREDR AQKIAETPEV EDVSVFPMAM       120
     PMIAGPGSIA TVMLLMSRAE GLSERLVVIG AVVVTLVLML ASLLAAGPIM ALLGAKIEAV       180
     ITRLLGVLLA ALAAQFVIDG LKASF                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page