(data stored in ACNUC7421 zone)

EMBL: AP010803.MGTE

AP010803.MGTE        Location/Qualifiers
FT   CDS             659150..660577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="SJA_C1-06540"
FT                   /product="magnesium transporter"
FT                   /note="Mg/Co/Ni transporter MgtE (contains CBS domain)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95488"
FT                   /db_xref="GOA:D4YYQ6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ6"
FT                   /protein_id="BAI95488.1"
FT                   /translation="MSERADTAEPRPDELGDIAAEQAESRHDEDDRLKGEFVSAVLDAV
FT                   EADDRDLARELVSPLHPADIADLLELTPSERRGQVAAALGDLVGAEVLSELNDYVRDDL
FT                   LDALLPEQVAEFAAELDTDDAVAIIEDMEEADQQAVLDAMEPEDRAAIESALSYPEESA
FT                   GRLMQRDLVAVPEHMTVGQVIDYLRDNRDLTSDFWEIFVVDEAHKPIGTCQLSWVLTCP
FT                   RSVAMADLMKREQTLIPVDMDQEEVALRFQKYALISAAVVDGSGRLVGMITVDDIVHII
FT                   SEEAGEDILRLSGAGEGDINQPILETVRTRLQWLVVNLGTAILAASVVGLFQSTISKYV
FT                   VLAVLMPIVSGMGGNAGTQTMAVAVRALATNQLTSSNTIRQIAREFRIASANGTALGIL
FT                   IGVAVGLIYGNHDLGIVIALAMLINNLVAGLAGILVPVTLDRMNIDPAVSSAVFVTAMT
FT                   DVMGFFSFLGLATVWGL"
     MSERADTAEP RPDELGDIAA EQAESRHDED DRLKGEFVSA VLDAVEADDR DLARELVSPL        60
     HPADIADLLE LTPSERRGQV AAALGDLVGA EVLSELNDYV RDDLLDALLP EQVAEFAAEL       120
     DTDDAVAIIE DMEEADQQAV LDAMEPEDRA AIESALSYPE ESAGRLMQRD LVAVPEHMTV       180
     GQVIDYLRDN RDLTSDFWEI FVVDEAHKPI GTCQLSWVLT CPRSVAMADL MKREQTLIPV       240
     DMDQEEVALR FQKYALISAA VVDGSGRLVG MITVDDIVHI ISEEAGEDIL RLSGAGEGDI       300
     NQPILETVRT RLQWLVVNLG TAILAASVVG LFQSTISKYV VLAVLMPIVS GMGGNAGTQT       360
     MAVAVRALAT NQLTSSNTIR QIAREFRIAS ANGTALGILI GVAVGLIYGN HDLGIVIALA       420
     MLINNLVAGL AGILVPVTLD RMNIDPAVSS AVFVTAMTDV MGFFSFLGLA TVWGL            475
//

If you have problems or comments...

PBIL Back to PBIL home page