(data stored in ACNUC7421 zone)

EMBL: AP010803.MSCS

AP010803.MSCS        Location/Qualifiers
FT   CDS             complement(687874..689133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS"
FT                   /gene_synonym="aefA"
FT                   /gene_synonym="kefA"
FT                   /locus_tag="SJA_C1-06880"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="potassium efflux system protein KefA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95522"
FT                   /db_xref="GOA:D4YYU0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU0"
FT                   /protein_id="BAI95522.1"
FT                   /translation="MTPGLHDLLSLLPGDPAVVHPLVALALAVAIHLVASAVARFASPR
FT                   LRRRFRALGEALAGHLRPILRHAIAAAVMALAVALWPIGDFAHLILGAALALSLSLLAV
FT                   HILRSLAIPRLAVLPIALLLFVMVLSGSSGGFAPVADMLDGVGLDLGKRRVTLLGLVSM
FT                   AAICVALFALVRLANRIVGRSITRAHGLDATQKLLAQKLAAIVVVVAAFFIGVDLLGID
FT                   LTAFAVFSGALGLAVGFGLQKTFGNLIAGIILLMDRSIKPGDVIVVGDSFGWVNKIGVR
FT                   AVSVITRDGKEHLIPNENLMTQEVENWSYSDRNVRVRIPVGIGYDSDLKLAQELMLRAA
FT                   QESPRVLRNPKPNVWLTAFGENRVEHDILVWISDPESGVGNVKSDVLGRLWLLFREHGI
FT                   TIPYPQRVIHAARDAAPPLP"
     MTPGLHDLLS LLPGDPAVVH PLVALALAVA IHLVASAVAR FASPRLRRRF RALGEALAGH        60
     LRPILRHAIA AAVMALAVAL WPIGDFAHLI LGAALALSLS LLAVHILRSL AIPRLAVLPI       120
     ALLLFVMVLS GSSGGFAPVA DMLDGVGLDL GKRRVTLLGL VSMAAICVAL FALVRLANRI       180
     VGRSITRAHG LDATQKLLAQ KLAAIVVVVA AFFIGVDLLG IDLTAFAVFS GALGLAVGFG       240
     LQKTFGNLIA GIILLMDRSI KPGDVIVVGD SFGWVNKIGV RAVSVITRDG KEHLIPNENL       300
     MTQEVENWSY SDRNVRVRIP VGIGYDSDLK LAQELMLRAA QESPRVLRNP KPNVWLTAFG       360
     ENRVEHDILV WISDPESGVG NVKSDVLGRL WLLFREHGIT IPYPQRVIHA ARDAAPPLP        419
//

If you have problems or comments...

PBIL Back to PBIL home page