(data stored in SCRATCH zone)

EMBL: AP010803.NDUFA9

AP010803.NDUFA9      Location/Qualifiers
FT   CDS             complement(260501..261439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NDUFA9"
FT                   /locus_tag="SJA_C1-02440"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 9"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /note="bifunctional protein"
FT                   /note="putative nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95078"
FT                   /db_xref="GOA:D4YXJ6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ6"
FT                   /protein_id="BAI95078.1"
FT                   /translation="MGRVMKDSLVTVFGGGGFLGRHVAQALMARGARVRVAQRDLATAL
FT                   RVKPLGALGQTQFVAADIRKPESVARAVAGSDIVINLVGVLSSDFQGSHHDGAANVAKA
FT                   AAEAGVGALVHISAIGADAQSPSAYGRSKAAGEEAVKAAFPSATIIRPSIVFGPEDQFL
FT                   NRFAEIIRFTPVVPVIGANTRFQPVYVADVAQAIANAAENPGLHGGKTYELGGPQTYSM
FT                   LELNAWIAKAIGRERSLCPVPASIASLIALLPGGPITRDQLAMLGRDNVAAPGAKGLAD
FT                   LGVAPTPMPAVAEKWLVRYRRHGRFAGRVQA"
     MGRVMKDSLV TVFGGGGFLG RHVAQALMAR GARVRVAQRD LATALRVKPL GALGQTQFVA        60
     ADIRKPESVA RAVAGSDIVI NLVGVLSSDF QGSHHDGAAN VAKAAAEAGV GALVHISAIG       120
     ADAQSPSAYG RSKAAGEEAV KAAFPSATII RPSIVFGPED QFLNRFAEII RFTPVVPVIG       180
     ANTRFQPVYV ADVAQAIANA AENPGLHGGK TYELGGPQTY SMLELNAWIA KAIGRERSLC       240
     PVPASIASLI ALLPGGPITR DQLAMLGRDN VAAPGAKGLA DLGVAPTPMP AVAEKWLVRY       300
     RRHGRFAGRV QA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page