(data stored in ACNUC7421 zone)

EMBL: AP010803.NUSB

AP010803.NUSB        Location/Qualifiers
FT   CDS             complement(294868..295314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SJA_C1-02780"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95112"
FT                   /db_xref="GOA:D4YXN0"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN0"
FT                   /protein_id="BAI95112.1"
FT                   /translation="MNDRSKSRSAARLAAVQALYQLEMEGTPLHLLLHEFHQHRLGATI
FT                   EDVTYAQAEESFFDDVVQGVDRRREEIDALIVARLSKGWSLERLDKPMRQILRAGTYEL
FT                   LARKDVATGTAISEYVDVAHAFYDKREAGFVNGLLDAVAKDVRK"
     MNDRSKSRSA ARLAAVQALY QLEMEGTPLH LLLHEFHQHR LGATIEDVTY AQAEESFFDD        60
     VVQGVDRRRE EIDALIVARL SKGWSLERLD KPMRQILRAG TYELLARKDV ATGTAISEYV       120
     DVAHAFYDKR EAGFVNGLLD AVAKDVRK                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page