(data stored in ACNUC7421 zone)

EMBL: AP010803.OPT

AP010803.OPT         Location/Qualifiers
FT   CDS             complement(696078..698045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opt"
FT                   /locus_tag="SJA_C1-06940"
FT                   /product="oligopeptide transporter OPT"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95528"
FT                   /db_xref="GOA:D4YYU6"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU6"
FT                   /protein_id="BAI95528.1"
FT                   /translation="MTGDSARAAPMAELTLRGVILGALITLLFTAANVYLGLKIGLTFA
FT                   TSIPAAVISMAVLRLFATGTILENNIVQTIASAAGTLSAIIFVLPGLVIIGWWQGFPYW
FT                   LSAFTIALGGILGVMYSVPLRRALVTGSDLPYPEGVAAAEVLKVGAGSREGLEENKRGL
FT                   AAIVASSVAAAAFSVLAKTKLIAEEAATFFKFGAGATSVSTSFSMALIGVGHLVGLSVG
FT                   VAMFFGLLISWVGLVPYLTAPLPSGADLSEIVGATFRMKARFIGAGTIGVAAIWTLLKI
FT                   LGPIVSGIRSALAAAKVRKGGNAGLLELTERDLPIGIVGGTILASLIPIAILLWLFAQG
FT                   GPIAANPVPIIGLTLAYILVAGIVIASVCGYMAGLIGASNSPISGVGILAVLGASLILA
FT                   AIYGSGGDPKQAQALIAYALFTTAIIFGIATISNDNLQDLKTGQLVGATPWKQQVALVL
FT                   GVIFGALVIPPVLDLLNSAFGFAGAPGAKETALPAPQAALISALAKGVLGGDLDWGLIG
FT                   FGAGIGVVVVAIDELLGKAGKLRLPPLAVGMGIYLPMALTLLIPVGAVIGHVYNRWALR
FT                   QSNPEFAERMGVLMATGFIVGESLFGVAFAGMVAATDSDAPLALVAENGWAVPLSILAF
FT                   FGVIAALYRRLRRWASAPLG"
     MTGDSARAAP MAELTLRGVI LGALITLLFT AANVYLGLKI GLTFATSIPA AVISMAVLRL        60
     FATGTILENN IVQTIASAAG TLSAIIFVLP GLVIIGWWQG FPYWLSAFTI ALGGILGVMY       120
     SVPLRRALVT GSDLPYPEGV AAAEVLKVGA GSREGLEENK RGLAAIVASS VAAAAFSVLA       180
     KTKLIAEEAA TFFKFGAGAT SVSTSFSMAL IGVGHLVGLS VGVAMFFGLL ISWVGLVPYL       240
     TAPLPSGADL SEIVGATFRM KARFIGAGTI GVAAIWTLLK ILGPIVSGIR SALAAAKVRK       300
     GGNAGLLELT ERDLPIGIVG GTILASLIPI AILLWLFAQG GPIAANPVPI IGLTLAYILV       360
     AGIVIASVCG YMAGLIGASN SPISGVGILA VLGASLILAA IYGSGGDPKQ AQALIAYALF       420
     TTAIIFGIAT ISNDNLQDLK TGQLVGATPW KQQVALVLGV IFGALVIPPV LDLLNSAFGF       480
     AGAPGAKETA LPAPQAALIS ALAKGVLGGD LDWGLIGFGA GIGVVVVAID ELLGKAGKLR       540
     LPPLAVGMGI YLPMALTLLI PVGAVIGHVY NRWALRQSNP EFAERMGVLM ATGFIVGESL       600
     FGVAFAGMVA ATDSDAPLAL VAENGWAVPL SILAFFGVIA ALYRRLRRWA SAPLG            655
//

If you have problems or comments...

PBIL Back to PBIL home page