(data stored in ACNUC7421 zone)

EMBL: AP010803.PAPD

AP010803.PAPD        Location/Qualifiers
FT   CDS             714671..715414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="papD"
FT                   /gene_synonym="fimC"
FT                   /locus_tag="SJA_C1-07050"
FT                   /product="P pilus assembly protein, chaperone PapD"
FT                   /note="putative pili assembly chaperone transmembrane
FT                   protein/fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95539"
FT                   /db_xref="GOA:D4YYV7"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV7"
FT                   /protein_id="BAI95539.1"
FT                   /translation="MIGQNLRGMIAALLASFPAAPLCAASLKIFPVRLLLTQDEPVQTM
FT                   TIANSSDTPTRVQLHIYSWRQDGEEDRLEETREVLANPGQFEIPAGGTQIARFGLRTGI
FT                   GPQEKSYRVILEEIPGMRAALPGQVETLLRVSIPIFVPPSRPSGRLSWRAWPSGNRNLT
FT                   LAIRNDGNAHVQINRLSLTKRNRREVGRQDMSTYLLPGSERRVTVPLGAPVAAGEALTV
FT                   IAMTDQAEMSADLVTEGPRHEEATP"
     MIGQNLRGMI AALLASFPAA PLCAASLKIF PVRLLLTQDE PVQTMTIANS SDTPTRVQLH        60
     IYSWRQDGEE DRLEETREVL ANPGQFEIPA GGTQIARFGL RTGIGPQEKS YRVILEEIPG       120
     MRAALPGQVE TLLRVSIPIF VPPSRPSGRL SWRAWPSGNR NLTLAIRNDG NAHVQINRLS       180
     LTKRNRREVG RQDMSTYLLP GSERRVTVPL GAPVAAGEAL TVIAMTDQAE MSADLVTEGP       240
     RHEEATP                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page