(data stored in ACNUC7421 zone)

EMBL: AP010803.PARA

AP010803.PARA        Location/Qualifiers
FT   CDS             complement(26688..27470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SJA_C1-00270"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94861"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWX9"
FT                   /protein_id="BAI94861.1"
FT                   /translation="MIRIAIANQKGGVGKTTTAINLATGLAATGLRVLLVDLDPQGNAS
FT                   TGLGVNQSDREQSSYDLLVGNCALEDAIISTRVPKLDIVPATQDLSGAEIELIEYEERT
FT                   HRLERVLAEAQPGRWDICLIDCPPSLGLLTINAMVAAQSLLVPLQCEFFALEGLSQLLQ
FT                   TVERIRGRFNPGLSIMGVALTMYDRRNRLTDQVADDVRACLGDLVFSTVIPRNVRLSEA
FT                   PSHGVPALIYDFRCSGSEAYMRLARELIARLPRQEVAA"
     MIRIAIANQK GGVGKTTTAI NLATGLAATG LRVLLVDLDP QGNASTGLGV NQSDREQSSY        60
     DLLVGNCALE DAIISTRVPK LDIVPATQDL SGAEIELIEY EERTHRLERV LAEAQPGRWD       120
     ICLIDCPPSL GLLTINAMVA AQSLLVPLQC EFFALEGLSQ LLQTVERIRG RFNPGLSIMG       180
     VALTMYDRRN RLTDQVADDV RACLGDLVFS TVIPRNVRLS EAPSHGVPAL IYDFRCSGSE       240
     AYMRLARELI ARLPRQEVAA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page