(data stored in SCRATCH zone)

EMBL: AP010803.PBP

AP010803.PBP         Location/Qualifiers
FT   CDS             complement(38312..40381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp"
FT                   /locus_tag="SJA_C1-00380"
FT                   /product="penicillin-binding protein"
FT                   /EC_number="2.4.1.129"
FT                   /note="membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94872"
FT                   /db_xref="GOA:D4YWZ0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ0"
FT                   /protein_id="BAI94872.1"
FT                   /translation="MARSSSEPRGRVKKWLIRGVKIGLVGFLSAAIAVVVAVAIAYQSL
FT                   PDYESLKSSPNGQMIRVHAADGSVIVSLGPSFGRWLSYDQIPTVMVDAMVSTEDKRYYL
FT                   HPGVDPIGMARAAWVAMERRGSGRRWQGASTITQQVTRNIFLNNSYSWGRKVREMVLAL
FT                   ALERKFSKRQILELYLNKVYFGGGAYGIDAASRKFFGHPATALNLPEAAIVAGLVKAPS
FT                   SYSPTADADAAIGRAGVVLDLMQENGKISAAERTAANLQDVKMAPEPPQNSVRYFTDWA
FT                   LPQLDTLIDEPNEPLEVYTTIDLGMQKAATAAIQANVPSGTQGALVSLDRDGAVRAMVG
FT                   GLDYVSSNYNRATTATRQPGSAWKIFVYMAALEAGYTPDTGVTDSPVDINGWKPRNSNG
FT                   RFSGDIDIRTAFAYSVNTVAAKLGVEVGFPTVADMARRFGVTTPINTHPSMVLGTSDVR
FT                   LIDMTRAFASIARKGVAVTPYGITKVTTAEGRVLYEHQDDTSRVLVAPWVAAGMTDLMQ
FT                   TAVSTGTGRAAQIGRPVAGKTGTTSSNKDGWFLGFSSGITTGVWMGRDDARAVGVLQGG
FT                   RAPARAFADYMKIAVAKRPVEQFETQVTLPEWQLEPDEEAYYGQPDGGTDGGMMVDENG
FT                   LPIERGQQPDEDAQPDDSGQPTPNPADRPQPPRLDQQWIDNVLGRNRQQQQPQH"
     MARSSSEPRG RVKKWLIRGV KIGLVGFLSA AIAVVVAVAI AYQSLPDYES LKSSPNGQMI        60
     RVHAADGSVI VSLGPSFGRW LSYDQIPTVM VDAMVSTEDK RYYLHPGVDP IGMARAAWVA       120
     MERRGSGRRW QGASTITQQV TRNIFLNNSY SWGRKVREMV LALALERKFS KRQILELYLN       180
     KVYFGGGAYG IDAASRKFFG HPATALNLPE AAIVAGLVKA PSSYSPTADA DAAIGRAGVV       240
     LDLMQENGKI SAAERTAANL QDVKMAPEPP QNSVRYFTDW ALPQLDTLID EPNEPLEVYT       300
     TIDLGMQKAA TAAIQANVPS GTQGALVSLD RDGAVRAMVG GLDYVSSNYN RATTATRQPG       360
     SAWKIFVYMA ALEAGYTPDT GVTDSPVDIN GWKPRNSNGR FSGDIDIRTA FAYSVNTVAA       420
     KLGVEVGFPT VADMARRFGV TTPINTHPSM VLGTSDVRLI DMTRAFASIA RKGVAVTPYG       480
     ITKVTTAEGR VLYEHQDDTS RVLVAPWVAA GMTDLMQTAV STGTGRAAQI GRPVAGKTGT       540
     TSSNKDGWFL GFSSGITTGV WMGRDDARAV GVLQGGRAPA RAFADYMKIA VAKRPVEQFE       600
     TQVTLPEWQL EPDEEAYYGQ PDGGTDGGMM VDENGLPIER GQQPDEDAQP DDSGQPTPNP       660
     ADRPQPPRLD QQWIDNVLGR NRQQQQPQH                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page