(data stored in SCRATCH zone)

EMBL: AP010803.PDXJ

AP010803.PDXJ        Location/Qualifiers
FT   CDS             complement(671141..671878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="SJA_C1-06670"
FT                   /product="pyridoxine 5-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /note="pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95501"
FT                   /db_xref="GOA:D4YYR9"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR9"
FT                   /protein_id="BAI95501.1"
FT                   /translation="MSRTPAHLRLGVNIDHVATIRNARGGTHPDPVKAALLAAKAGADG
FT                   ITAHLREDRRHIRDEDIATLMAALTVPLNLEMAATQEMLGIALRHRPHAACIVPEKREE
FT                   RTTEGGLDAAGQIDALHPIVDALGKAGVRVSLFIEPDAAQIEAAMRLGAPVVELHTGRY
FT                   AHLEGSERAEELRRLADAAALAAKNGIEPHAGHGLTFDNVGPVAAIPQIAELNIGHFLI
FT                   GEAIFGGLESSIREMRRQMDLAR"
     MSRTPAHLRL GVNIDHVATI RNARGGTHPD PVKAALLAAK AGADGITAHL REDRRHIRDE        60
     DIATLMAALT VPLNLEMAAT QEMLGIALRH RPHAACIVPE KREERTTEGG LDAAGQIDAL       120
     HPIVDALGKA GVRVSLFIEP DAAQIEAAMR LGAPVVELHT GRYAHLEGSE RAEELRRLAD       180
     AAALAAKNGI EPHAGHGLTF DNVGPVAAIP QIAELNIGHF LIGEAIFGGL ESSIREMRRQ       240
     MDLAR                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page