(data stored in ACNUC7421 zone)

EMBL: AP010803.PE1

AP010803.PE1         Location/Qualifiers
FT   CDS             154..975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00010"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94835"
FT                   /db_xref="GOA:D4YWV3"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV3"
FT                   /protein_id="BAI94835.1"
FT                   /translation="MSRIHLHLLSDSTGETLENIAKAAIGAFENVEAVRHFWPMVRSDV
FT                   HLDRIMEEIAANPGLVLFTLSNHQLRRRLETRCRALGLPHVAALDSVTDALSNILGQET
FT                   RNRPGRKHILDEAYFARIEAIQFTIAHDDGVGHENWEEADIVLAGVSRASKTPTSIYLA
FT                   NRGYKTANIPLVIQSPPPPALYSLKHPMVVGLTVSPERLVQIRRNRLLSLNQAPETSYV
FT                   NLDKVQEELAFARRMFADNGWPVIDMTRRSIEEAAAAIINLFNDRVLAEGA"
     MSRIHLHLLS DSTGETLENI AKAAIGAFEN VEAVRHFWPM VRSDVHLDRI MEEIAANPGL        60
     VLFTLSNHQL RRRLETRCRA LGLPHVAALD SVTDALSNIL GQETRNRPGR KHILDEAYFA       120
     RIEAIQFTIA HDDGVGHENW EEADIVLAGV SRASKTPTSI YLANRGYKTA NIPLVIQSPP       180
     PPALYSLKHP MVVGLTVSPE RLVQIRRNRL LSLNQAPETS YVNLDKVQEE LAFARRMFAD       240
     NGWPVIDMTR RSIEEAAAAI INLFNDRVLA EGA                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page