(data stored in ACNUC7421 zone)

EMBL: AP010803.PE103

AP010803.PE103       Location/Qualifiers
FT   CDS             103712..104032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94937"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX55"
FT                   /protein_id="BAI94937.1"
FT                   /translation="MLAILADLLRRVDGLAGERGHVSVARLRDEIDRIRHIARAFHLDG
FT                   VGSLAGTLQSALSLQGAGPVVMSYLDLMRDAISAEMPAAAEVLAMPVAARPAVGPGARL
FT                   TA"
     MLAILADLLR RVDGLAGERG HVSVARLRDE IDRIRHIARA FHLDGVGSLA GTLQSALSLQ        60
     GAGPVVMSYL DLMRDAISAE MPAAAEVLAM PVAARPAVGP GARLTA                      106
//

If you have problems or comments...

PBIL Back to PBIL home page