(data stored in ACNUC7421 zone)

EMBL: AP010803.PE108

AP010803.PE108       Location/Qualifiers
FT   CDS             complement(107696..108481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01080"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94942"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX60"
FT                   /protein_id="BAI94942.1"
FT                   /translation="MSEPAALTPEEGRLPLESAFNLRDFGGYATADGRCVKRGMLYRSG
FT                   TMALLTDGDADHLRSLGIRAICDFRRGNERTAEPTLWHGADVDYFCRDYTESSGLLGEM
FT                   LQREGATADDMRRTMIALYRMIPVDHAASYRAMFERIADGRVPLLINCSAGKDRTGVGA
FT                   ALILAALGVPRPTIVQDYLATNAHADWDWLLAQRDTLVARMRLAGADMLEPLLRAESAY
FT                   LDSFFAALDESHGGVDDYLNDMLGVDAAARDAMRGMLLD"
     MSEPAALTPE EGRLPLESAF NLRDFGGYAT ADGRCVKRGM LYRSGTMALL TDGDADHLRS        60
     LGIRAICDFR RGNERTAEPT LWHGADVDYF CRDYTESSGL LGEMLQREGA TADDMRRTMI       120
     ALYRMIPVDH AASYRAMFER IADGRVPLLI NCSAGKDRTG VGAALILAAL GVPRPTIVQD       180
     YLATNAHADW DWLLAQRDTL VARMRLAGAD MLEPLLRAES AYLDSFFAAL DESHGGVDDY       240
     LNDMLGVDAA ARDAMRGMLL D                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page