(data stored in ACNUC7421 zone)

EMBL: AP010803.PE109

AP010803.PE109       Location/Qualifiers
FT   CDS             complement(108478..108900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01090"
FT                   /product="OsmC-like protein"
FT                   /note="osmotically inducible protein / putative redox
FT                   protein, regulator of disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94943"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX61"
FT                   /protein_id="BAI94943.1"
FT                   /translation="MIVVERIDPDGGTAHRISIRGHELIADMSAPDGHDAGPDPHDLYD
FT                   SALGACKAMTMLWYAQRNGIPVEGIHVGVVRDASQERKGVYKLTTRIALSGPLSAEQHD
FT                   RLIAVAAKCPVHKLMSEVETQIETIAVPYVGEGERP"
     MIVVERIDPD GGTAHRISIR GHELIADMSA PDGHDAGPDP HDLYDSALGA CKAMTMLWYA        60
     QRNGIPVEGI HVGVVRDASQ ERKGVYKLTT RIALSGPLSA EQHDRLIAVA AKCPVHKLMS       120
     EVETQIETIA VPYVGEGERP                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page