(data stored in ACNUC7421 zone)

EMBL: AP010803.PE11

AP010803.PE11        Location/Qualifiers
FT   CDS             6743..7237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00110"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94845"
FT                   /db_xref="GOA:D4YWW3"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW3"
FT                   /protein_id="BAI94845.1"
FT                   /translation="MESDLSDSCSPLTDGTALAVARGTLRLFFRHDMSGILEVPLPNGR
FT                   RADIMALDGAGRITIVEIKCSRADLLGDMKWPDYFDYCDRYFWAVPSGFDLSLFESEAL
FT                   WPGRTGLIVADRYDAELVRPAPMEPLAAARRKAETLRFARRAARRLTALADPDHAAELG
FT                   W"
     MESDLSDSCS PLTDGTALAV ARGTLRLFFR HDMSGILEVP LPNGRRADIM ALDGAGRITI        60
     VEIKCSRADL LGDMKWPDYF DYCDRYFWAV PSGFDLSLFE SEALWPGRTG LIVADRYDAE       120
     LVRPAPMEPL AAARRKAETL RFARRAARRL TALADPDHAA ELGW                        164
//

If you have problems or comments...

PBIL Back to PBIL home page