(data stored in ACNUC7421 zone)

EMBL: AP010803.PE112

AP010803.PE112       Location/Qualifiers
FT   CDS             110710..110997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01120"
FT                   /product="BolA-like protein"
FT                   /note="stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94946"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX64"
FT                   /protein_id="BAI94946.1"
FT                   /translation="MTEILKGPVATEIEARLRAALAPERLAVIDDSEKHRGHAGHDGSG
FT                   ESHFTVDIVSDRFAGRNRVARQRLVNAALADLLRDKVHALAIKARAPGEA"
     MTEILKGPVA TEIEARLRAA LAPERLAVID DSEKHRGHAG HDGSGESHFT VDIVSDRFAG        60
     RNRVARQRLV NAALADLLRD KVHALAIKAR APGEA                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page