(data stored in ACNUC7421 zone)

EMBL: AP010803.PE114

AP010803.PE114       Location/Qualifiers
FT   CDS             111750..112673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01140"
FT                   /product="pirin-related protein"
FT                   /note="pirin (iron-binding nuclear protein)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94948"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX66"
FT                   /protein_id="BAI94948.1"
FT                   /translation="MTPPESIIQNDPIIQTITPTSHNLGDFRVHRSLPAKERTMVGPFI
FT                   FFDQAGPARIAPGQGVDVRPHPHINLATVTYMYEGSFLHRDSLGTEQLIEPGAVNLMTA
FT                   GKGIVHSERSPDEDRAKLSKLSAIQTWLALPDRYEEMDPAFEHVGEGGLPVIDGGHARA
FT                   RVIMGSLWGQTSPVTTYANTIYADIQLAPGGSVPIDADAEERAIYVSGGDAALDGVMLQ
FT                   PQTLYVLRPGIRATLMSVDGGRAILCGGEAFRTPRHVWWNFVSSTTDRLMQAREDWEAM
FT                   RFPLIPGDDREFIPIPQGRPKTVSYP"
     MTPPESIIQN DPIIQTITPT SHNLGDFRVH RSLPAKERTM VGPFIFFDQA GPARIAPGQG        60
     VDVRPHPHIN LATVTYMYEG SFLHRDSLGT EQLIEPGAVN LMTAGKGIVH SERSPDEDRA       120
     KLSKLSAIQT WLALPDRYEE MDPAFEHVGE GGLPVIDGGH ARARVIMGSL WGQTSPVTTY       180
     ANTIYADIQL APGGSVPIDA DAEERAIYVS GGDAALDGVM LQPQTLYVLR PGIRATLMSV       240
     DGGRAILCGG EAFRTPRHVW WNFVSSTTDR LMQAREDWEA MRFPLIPGDD REFIPIPQGR       300
     PKTVSYP                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page