(data stored in ACNUC7421 zone)

EMBL: AP010803.PE115

AP010803.PE115       Location/Qualifiers
FT   CDS             complement(112796..113626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94949"
FT                   /db_xref="GOA:D4YX67"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX67"
FT                   /protein_id="BAI94949.1"
FT                   /translation="MILVCPNCATRYIVPDSAVGPNGRQVRCAACKHSWFQEGAALAPR
FT                   EEALATSGMPEVAAPPPPPAPPPPPPPPPPVEEPAAPTVEPVAAPEESEPVAQAASPEA
FT                   ARPDYRFDDVYGRAEADARDDWVEPEPATAKPRRNRLKIWTYAALAFCLAVGAAGGALW
FT                   YFGAPGWAVNLGLVPEEGDPDLLFYLSKPAERRKLPTGEEYFAFGARIVNSGKQVLPVP
FT                   PVLVQLRDRQNRLVFSWTTKADRTSLKPGEEASINESRIDIPKNAENLSLTFVQ"
     MILVCPNCAT RYIVPDSAVG PNGRQVRCAA CKHSWFQEGA ALAPREEALA TSGMPEVAAP        60
     PPPPAPPPPP PPPPPVEEPA APTVEPVAAP EESEPVAQAA SPEAARPDYR FDDVYGRAEA       120
     DARDDWVEPE PATAKPRRNR LKIWTYAALA FCLAVGAAGG ALWYFGAPGW AVNLGLVPEE       180
     GDPDLLFYLS KPAERRKLPT GEEYFAFGAR IVNSGKQVLP VPPVLVQLRD RQNRLVFSWT       240
     TKADRTSLKP GEEASINESR IDIPKNAENL SLTFVQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page