(data stored in ACNUC7421 zone)

EMBL: AP010803.PE118

AP010803.PE118       Location/Qualifiers
FT   CDS             115428..115958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01180"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94952"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX70"
FT                   /protein_id="BAI94952.1"
FT                   /translation="MIVRFIAVTLLGWMLGFAWFAIFLPQPLDGRQTDAIVVLTGGAGR
FT                   IDRGLALLQDGAAKRMLISGVDRSVRPVELAAQYKVPERLFSCCITLGREAIDTRSNAI
FT                   ETAHWLERRDFKTVRLITTDWHMRRSALELRQALPERVTLVYDAVPSRPSLTMLAREYN
FT                   KYLLRRAAALIGI"
     MIVRFIAVTL LGWMLGFAWF AIFLPQPLDG RQTDAIVVLT GGAGRIDRGL ALLQDGAAKR        60
     MLISGVDRSV RPVELAAQYK VPERLFSCCI TLGREAIDTR SNAIETAHWL ERRDFKTVRL       120
     ITTDWHMRRS ALELRQALPE RVTLVYDAVP SRPSLTMLAR EYNKYLLRRA AALIGI           176
//

If you have problems or comments...

PBIL Back to PBIL home page