(data stored in ACNUC7421 zone)

EMBL: AP010803.PE126

AP010803.PE126       Location/Qualifiers
FT   CDS             complement(125710..126531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01260"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94960"
FT                   /db_xref="GOA:D4YX78"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX78"
FT                   /protein_id="BAI94960.1"
FT                   /translation="MVGQAGGDATGVAVVTGASSGIGAVYADRLAARGHDLLLVARRAD
FT                   RLRQLAQELSDRHGVQVQTATADLAEPESLARVEALVRESNAVLLVNNAGAGGLGPTAA
FT                   ISADRVENVVRLNITALSRLSHAVLEGFRSRGAGTLVNIGSIIALSPSPSAAAYSGSKA
FT                   YVLNFTRSLQAEYADTAIRIQLVQPGPIRTEFFTAAGVSESVFPEDSYLTAEQLVDAAL
FT                   AGLDAGELVTTPTVAETGIWEALEAARLAFMEAARSGQVAERYRVGEESLA"
     MVGQAGGDAT GVAVVTGASS GIGAVYADRL AARGHDLLLV ARRADRLRQL AQELSDRHGV        60
     QVQTATADLA EPESLARVEA LVRESNAVLL VNNAGAGGLG PTAAISADRV ENVVRLNITA       120
     LSRLSHAVLE GFRSRGAGTL VNIGSIIALS PSPSAAAYSG SKAYVLNFTR SLQAEYADTA       180
     IRIQLVQPGP IRTEFFTAAG VSESVFPEDS YLTAEQLVDA ALAGLDAGEL VTTPTVAETG       240
     IWEALEAARL AFMEAARSGQ VAERYRVGEE SLA                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page