(data stored in ACNUC7421 zone)

EMBL: AP010803.PE129

AP010803.PE129       Location/Qualifiers
FT   CDS             complement(128877..131390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01290"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94963"
FT                   /db_xref="GOA:D4YX81"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX81"
FT                   /protein_id="BAI94963.1"
FT                   /translation="MPKKKRYAALLARLMATGAALSIGGIGMAAHAQIAAASAEADAGE
FT                   AIVVTGLRGLSSKTAVESPAPIDIVPADRLTGTGRQEIGEALARTLPSINFGRTGAGVA
FT                   SIVRPIFNRSLPPAYTLILVDGKRRHNSALLTNGGGDTSGFGPVDLDFIPIAGVRSVEV
FT                   LKDSAAAQYGSDAVAGVINFVLNDRPQPNHVSVTYGDHYKSYGDPWSAKAEGGLGFGLG
FT                   DGGYVNLSGDLRGRGMSWRGFRATNRLLYAPASNPKNAAWDGIGAHNGDPRIRAFNLGL
FT                   DAALPAGDVTLYTQATFGRRKAEIGNMIRRPSGTASFSTVFPDGYFPVNNTSETDFQFL
FT                   AGIRGDLSGWQWDFSSSYGRNQVRMYSDLTLNPSLGPTGPTSFDNLARFRFSQWTNNLD
FT                   VSRDIDIGLAKPLHVQWGLEARREVFQTFAGDPLGYANGGYVIKAGDQEGNPNVGSIAS
FT                   IGAQGAITISPATTAHVSRNVFAGYIDLGLTITPRWYVDIAGRAEHYGLGAGSTVGGKV
FT                   NSRYELSSWLAVRGTVGTGFRAPSLSQIGYAQTDNRTAISPATGLLVAATTQTAPTTSA
FT                   LATALGAATLKPEKTWNAGLGIALQPTRNLSLTIDGYQIDIDDRIARTASLSGPALNAI
FT                   FAANGLPPGTFVQYFANAADTRTRGVDIVGNYTADLSTLGQLSLSAAYSYSRTKIRHVA
FT                   ATPAALVGLGPNPGGSLVAFGNVFRGEIADNQPRSKLALASKWSLDPVSVDLRVTRYGR
FT                   YRYLRTENPAQNLSYGGRWITDLEVSLALTSRLGVAVGAANLFSVRPDNSGVNEPTSGV
FT                   TLFNYGSPPFDSSGGFYYGRINWTF"
     MPKKKRYAAL LARLMATGAA LSIGGIGMAA HAQIAAASAE ADAGEAIVVT GLRGLSSKTA        60
     VESPAPIDIV PADRLTGTGR QEIGEALART LPSINFGRTG AGVASIVRPI FNRSLPPAYT       120
     LILVDGKRRH NSALLTNGGG DTSGFGPVDL DFIPIAGVRS VEVLKDSAAA QYGSDAVAGV       180
     INFVLNDRPQ PNHVSVTYGD HYKSYGDPWS AKAEGGLGFG LGDGGYVNLS GDLRGRGMSW       240
     RGFRATNRLL YAPASNPKNA AWDGIGAHNG DPRIRAFNLG LDAALPAGDV TLYTQATFGR       300
     RKAEIGNMIR RPSGTASFST VFPDGYFPVN NTSETDFQFL AGIRGDLSGW QWDFSSSYGR       360
     NQVRMYSDLT LNPSLGPTGP TSFDNLARFR FSQWTNNLDV SRDIDIGLAK PLHVQWGLEA       420
     RREVFQTFAG DPLGYANGGY VIKAGDQEGN PNVGSIASIG AQGAITISPA TTAHVSRNVF       480
     AGYIDLGLTI TPRWYVDIAG RAEHYGLGAG STVGGKVNSR YELSSWLAVR GTVGTGFRAP       540
     SLSQIGYAQT DNRTAISPAT GLLVAATTQT APTTSALATA LGAATLKPEK TWNAGLGIAL       600
     QPTRNLSLTI DGYQIDIDDR IARTASLSGP ALNAIFAANG LPPGTFVQYF ANAADTRTRG       660
     VDIVGNYTAD LSTLGQLSLS AAYSYSRTKI RHVAATPAAL VGLGPNPGGS LVAFGNVFRG       720
     EIADNQPRSK LALASKWSLD PVSVDLRVTR YGRYRYLRTE NPAQNLSYGG RWITDLEVSL       780
     ALTSRLGVAV GAANLFSVRP DNSGVNEPTS GVTLFNYGSP PFDSSGGFYY GRINWTF          837
//

If you have problems or comments...

PBIL Back to PBIL home page