(data stored in ACNUC7421 zone)

EMBL: AP010803.PE13

AP010803.PE13        Location/Qualifiers
FT   CDS             7854..8600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00130"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94847"
FT                   /db_xref="GOA:D4YWW5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW5"
FT                   /protein_id="BAI94847.1"
FT                   /translation="MTTDSIEAADRLAANRLAGIRAAMGRTASLTGRTADDITLIAVSK
FT                   TQAADAIRPLIAAGQRVFGENRVQEAESKWPALRDEHDGLQLHLVGQLQSNKAADAVAL
FT                   FDVIHSLDRPSLLTALARAMDAADRRVPCFVQVNIGAEPQKGGCPIADVPALIRSAREA
FT                   GIPLLGLMCVPPADIEPAPFFALLAKMAREEGLEGLSMGMSGDYETAIMLGATHIRVGT
FT                   ALFGERPAARPTPGSGRGMIRNSRAK"
     MTTDSIEAAD RLAANRLAGI RAAMGRTASL TGRTADDITL IAVSKTQAAD AIRPLIAAGQ        60
     RVFGENRVQE AESKWPALRD EHDGLQLHLV GQLQSNKAAD AVALFDVIHS LDRPSLLTAL       120
     ARAMDAADRR VPCFVQVNIG AEPQKGGCPI ADVPALIRSA REAGIPLLGL MCVPPADIEP       180
     APFFALLAKM AREEGLEGLS MGMSGDYETA IMLGATHIRV GTALFGERPA ARPTPGSGRG       240
     MIRNSRAK                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page