(data stored in SCRATCH zone)

EMBL: AP010803.PE132

AP010803.PE132       Location/Qualifiers
FT   CDS             complement(134298..136691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01320"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94966"
FT                   /db_xref="GOA:D4YX84"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX84"
FT                   /protein_id="BAI94966.1"
FT                   /translation="MSIRHTASPLALAIILAATSPQTQAAEREAAADMAAVDAVDSADA
FT                   GSAIIITARRRNEKIQDVPVAANSYGGEQIEATRTYNLRDLQALSPSLVVTVTNPRNTS
FT                   INIRGLGNNVSVYNDGLEPAVGVYMDQVYLARPGQAVFDLADIERIEVLRGPQGTLFGK
FT                   NTSAGAVVITTKSPTFEPEIGGDLTYGNYDFRQLHAYASGALIDDKLAARIYVSKTDRD
FT                   GYVTNRYDDSRTQDYHDFGLRGQLLFTPTDNFKLRLIGDYGFQKQRTAAAVLTGVIRTY
FT                   DNGGNFANNYTDRTARLGVPVVADAPGERIVDMDGNPRYKMRQGGVSAIADLALPGHSL
FT                   TSVTSWRRWDWYPHNDGDSTRLDAGRDFHQSNNQQQFSQELRIASEGERKVDYIAGLYY
FT                   LWQSIKAEALNAYGADAAPWFLAPTVDPAVGAAALNNYTVLSHSKPVTNSYAAFGQTIW
FT                   HVTPTIDLTTGLRYTYETKSGWFDQEATGADLSGLTTAQQAAAQAIRARYGVANHYEAK
FT                   TKEGRLSGQATLSWKVTPDALLYATYGRGNKFGGLNLANIVTTGQFAVDPVIKPETIDS
FT                   YELGLKTSWSGGKLTVNLAGFWTDVSDYQTTIVDTAPDRNNISYFTNVGKVRTRGFEGD
FT                   IRLVPAAWLSLYGSGTYTDAQYVSYPNAPCPIETTGIVSCNLSGDRLPGVSKWAFSAGG
FT                   EAKAAIGNRLGHEAEVYAGADFSYRSNFYTTASLSRYSLIPGYSLLNARIGVRALDGAL
FT                   DLQLWGRNLFDKDYFQSLSAANTGAITGTLGDPRTYGVTLRTRF"
     MSIRHTASPL ALAIILAATS PQTQAAEREA AADMAAVDAV DSADAGSAII ITARRRNEKI        60
     QDVPVAANSY GGEQIEATRT YNLRDLQALS PSLVVTVTNP RNTSINIRGL GNNVSVYNDG       120
     LEPAVGVYMD QVYLARPGQA VFDLADIERI EVLRGPQGTL FGKNTSAGAV VITTKSPTFE       180
     PEIGGDLTYG NYDFRQLHAY ASGALIDDKL AARIYVSKTD RDGYVTNRYD DSRTQDYHDF       240
     GLRGQLLFTP TDNFKLRLIG DYGFQKQRTA AAVLTGVIRT YDNGGNFANN YTDRTARLGV       300
     PVVADAPGER IVDMDGNPRY KMRQGGVSAI ADLALPGHSL TSVTSWRRWD WYPHNDGDST       360
     RLDAGRDFHQ SNNQQQFSQE LRIASEGERK VDYIAGLYYL WQSIKAEALN AYGADAAPWF       420
     LAPTVDPAVG AAALNNYTVL SHSKPVTNSY AAFGQTIWHV TPTIDLTTGL RYTYETKSGW       480
     FDQEATGADL SGLTTAQQAA AQAIRARYGV ANHYEAKTKE GRLSGQATLS WKVTPDALLY       540
     ATYGRGNKFG GLNLANIVTT GQFAVDPVIK PETIDSYELG LKTSWSGGKL TVNLAGFWTD       600
     VSDYQTTIVD TAPDRNNISY FTNVGKVRTR GFEGDIRLVP AAWLSLYGSG TYTDAQYVSY       660
     PNAPCPIETT GIVSCNLSGD RLPGVSKWAF SAGGEAKAAI GNRLGHEAEV YAGADFSYRS       720
     NFYTTASLSR YSLIPGYSLL NARIGVRALD GALDLQLWGR NLFDKDYFQS LSAANTGAIT       780
     GTLGDPRTYG VTLRTRF                                                      797
//

If you have problems or comments...

PBIL Back to PBIL home page