(data stored in ACNUC7421 zone)

EMBL: AP010803.PE134

AP010803.PE134       Location/Qualifiers
FT   CDS             138617..139498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01340"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94968"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX86"
FT                   /protein_id="BAI94968.1"
FT                   /translation="MSHGRRHAGAFAACAIALLGAAPPPAASPGPRCDARDGRVLVPAG
FT                   TVLLGEDGDGRPGQAVAVPAFWIDRHEVTNRQFAAFVAATGYRTAAEQEGGSAVFVQPT
FT                   GPVDLNNAGNWWRYRQRADWRHPDGPGSDIAGREDWPVVHVNYQDAAAYARWAGAALPD
FT                   EAQWERAARGDQSGPRDPRSWAYDGEGHPTANSWQGVFPVRDTGQDGHVGLAPVGCFDG
FT                   NGFGLHDMVGNVWEWTSERRGGNGLIKGGSYLCAMNYCANFRPAAFQAQELDLGTSHIG
FT                   FRTIATEPDPSS"
     MSHGRRHAGA FAACAIALLG AAPPPAASPG PRCDARDGRV LVPAGTVLLG EDGDGRPGQA        60
     VAVPAFWIDR HEVTNRQFAA FVAATGYRTA AEQEGGSAVF VQPTGPVDLN NAGNWWRYRQ       120
     RADWRHPDGP GSDIAGREDW PVVHVNYQDA AAYARWAGAA LPDEAQWERA ARGDQSGPRD       180
     PRSWAYDGEG HPTANSWQGV FPVRDTGQDG HVGLAPVGCF DGNGFGLHDM VGNVWEWTSE       240
     RRGGNGLIKG GSYLCAMNYC ANFRPAAFQA QELDLGTSHI GFRTIATEPD PSS              293
//

If you have problems or comments...

PBIL Back to PBIL home page