(data stored in ACNUC7421 zone)

EMBL: AP010803.PE135

AP010803.PE135       Location/Qualifiers
FT   CDS             complement(139620..139889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94969"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX87"
FT                   /protein_id="BAI94969.1"
FT                   /translation="MAILSDRQRQCRRSVLGRIDISEDVEPKMPAFREPERSVARQRGQ
FT                   IRKCREMANFGHCPTVTPDLIRGPAFLSECPPCPRQRDPGSSPG"
     MAILSDRQRQ CRRSVLGRID ISEDVEPKMP AFREPERSVA RQRGQIRKCR EMANFGHCPT        60
     VTPDLIRGPA FLSECPPCPR QRDPGSSPG                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page