(data stored in ACNUC7421 zone)

EMBL: AP010803.PE137

AP010803.PE137       Location/Qualifiers
FT   CDS             complement(140322..140537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94971"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX89"
FT                   /protein_id="BAI94971.1"
FT                   /translation="MQQLAFYVSNHDISLPSSFINSYIVVHKLHVYTGNLCKKAAPTRS
FT                   LGRGRRVPLLQLSPALRYKCRHEVGL"
     MQQLAFYVSN HDISLPSSFI NSYIVVHKLH VYTGNLCKKA APTRSLGRGR RVPLLQLSPA        60
     LRYKCRHEVG L                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page