(data stored in ACNUC7421 zone)

EMBL: AP010803.PE138

AP010803.PE138       Location/Qualifiers
FT   CDS             140604..142982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01380"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94972"
FT                   /db_xref="GOA:D4YX90"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX90"
FT                   /protein_id="BAI94972.1"
FT                   /translation="MSQEAPAQDGQNEGGLQEIIVTAQTRAQKLQEVPISVVAVQGTDL
FT                   ATKAVIRPIDLQIAAPGFTATETAFATQFFIRGIGSGLNAGFEQSVGLYVDGVHLPRSL
FT                   QTRIPFLDVDRVEVLRGPQSILLGKNAIAGALNVTTAKPTQDFFGRLTSSYEFNANELG
FT                   LEGAVSGPITDTIRVRVAGKYRSSDGYIRNLTLNRLEPARDEAAIRVTADIDVTQDLQL
FT                   SFKSEYNQFNTDGKAMEIYGEEPAKAGPFAGLTYAQVLVNVFHLDPTLLDNRIDGRRTS
FT                   DGEKSRAHATANVLTLNWQTGGYTLRSTTAYTTALADDDAINPDLLGARIITGHIRDNY
FT                   TQFSQELRLISPKFDSFDFIAGAYYANGLQRYRQAVGFPSDSTFVTIVNARQPGAGTLV
FT                   ANTWINRRVRVEADTFSAFGQLNWRPISDVTVQLGGRLSYSKIQGSKILTVEPIGGGAL
FT                   PAAQVNAPLVYAQVLAASSSNLAGLGAAGNAMINRLGEFPVAGTRRETRFTPDVKILYR
FT                   PTPQVMLYAGYARGQKSGGFDFAANNRLTYPTARDAFEFDDEKAQNFEVGSKMSLLGGR
FT                   AELNLAAYYTKLTNLQISIFDGRLGFNVGNAASARAQGIEANGRMQLGRHFTLSTGVNY
FT                   TDFKYLRFPNGQCYFGQTPTVDGNGDGVPEFCDYKGKSSQLTSKVTANASLTSVFPIFD
FT                   GYQIGTTTEVFYASAYDAAANYDPAGRQAKYALLNMRVGVGPENGSWELAFVGRNLTDK
FT                   QVFQFVGDTAIAATVAQAKSNYAILSQGRTLAIQLNAKF"
     MSQEAPAQDG QNEGGLQEII VTAQTRAQKL QEVPISVVAV QGTDLATKAV IRPIDLQIAA        60
     PGFTATETAF ATQFFIRGIG SGLNAGFEQS VGLYVDGVHL PRSLQTRIPF LDVDRVEVLR       120
     GPQSILLGKN AIAGALNVTT AKPTQDFFGR LTSSYEFNAN ELGLEGAVSG PITDTIRVRV       180
     AGKYRSSDGY IRNLTLNRLE PARDEAAIRV TADIDVTQDL QLSFKSEYNQ FNTDGKAMEI       240
     YGEEPAKAGP FAGLTYAQVL VNVFHLDPTL LDNRIDGRRT SDGEKSRAHA TANVLTLNWQ       300
     TGGYTLRSTT AYTTALADDD AINPDLLGAR IITGHIRDNY TQFSQELRLI SPKFDSFDFI       360
     AGAYYANGLQ RYRQAVGFPS DSTFVTIVNA RQPGAGTLVA NTWINRRVRV EADTFSAFGQ       420
     LNWRPISDVT VQLGGRLSYS KIQGSKILTV EPIGGGALPA AQVNAPLVYA QVLAASSSNL       480
     AGLGAAGNAM INRLGEFPVA GTRRETRFTP DVKILYRPTP QVMLYAGYAR GQKSGGFDFA       540
     ANNRLTYPTA RDAFEFDDEK AQNFEVGSKM SLLGGRAELN LAAYYTKLTN LQISIFDGRL       600
     GFNVGNAASA RAQGIEANGR MQLGRHFTLS TGVNYTDFKY LRFPNGQCYF GQTPTVDGNG       660
     DGVPEFCDYK GKSSQLTSKV TANASLTSVF PIFDGYQIGT TTEVFYASAY DAAANYDPAG       720
     RQAKYALLNM RVGVGPENGS WELAFVGRNL TDKQVFQFVG DTAIAATVAQ AKSNYAILSQ       780
     GRTLAIQLNA KF                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page