(data stored in ACNUC7421 zone)

EMBL: AP010803.PE139

AP010803.PE139       Location/Qualifiers
FT   CDS             143010..143786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01390"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94973"
FT                   /db_xref="GOA:D4YX91"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX91"
FT                   /protein_id="BAI94973.1"
FT                   /translation="MDARKLFNLEGKTALITGGTRGIGFMIAQGLVQVGVKTYVTSRKA
FT                   ETCQEAEAELRKIGEAYAIPADVADADQVAALAAEFSRREDKLHILVNNAGTSWGEPFD
FT                   QFPQSGWDKVMHLNLGAVFFLTQKLAPLLRNAATSDDPARVINIGSVDGLTAPAVENYP
FT                   YSASKAAVHHLTRHLARFLAESHINVNAIAPGPFPTKMTEWLLQEHGEEINSMIPRRRT
FT                   GTPGDAAGTTIFLASPASSYITGAVIPLDGGFSTTR"
     MDARKLFNLE GKTALITGGT RGIGFMIAQG LVQVGVKTYV TSRKAETCQE AEAELRKIGE        60
     AYAIPADVAD ADQVAALAAE FSRREDKLHI LVNNAGTSWG EPFDQFPQSG WDKVMHLNLG       120
     AVFFLTQKLA PLLRNAATSD DPARVINIGS VDGLTAPAVE NYPYSASKAA VHHLTRHLAR       180
     FLAESHINVN AIAPGPFPTK MTEWLLQEHG EEINSMIPRR RTGTPGDAAG TTIFLASPAS       240
     SYITGAVIPL DGGFSTTR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page